KEGG   Rattus norvegicus (rat): 312916Help
Entry
312916            CDS       T01003                                 

Gene name
Cops5
Definition
(RefSeq) COP9 signalosome subunit 5
  KO
K09613  COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    312916 (Cops5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    312916 (Cops5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     312916 (Cops5)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M67
   312916 (Cops5)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    312916 (Cops5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JAB CSN5_C Prok-JAB UPF0172
Motif
Other DBs
NCBI-GeneID: 312916
NCBI-ProteinID: NP_001020866
RGD: 1310301
Ensembl: ENSRNOG00000006499
UniProt: Q4KM69
Position
5q11
AA seq 334 aa AA seqDB search
MTASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINVA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttccgggagtggtatggcccagaagacctgggaattggccaacaacatgcag
gaagcgcagagtatcgatgaaatctacaaatatgacaaaaaacaacaacaagaaatcctg
gcggcgaaaccctggactaaggatcaccactactttaaatactgcaaaatctctgcgttg
gcactgctgaaaatggtgatgcatgccaggtcaggaggcaacctggaggtgatgggtttg
atgctcgggaaagtggatggagagaccatgatcatcatggacagctttgctttgcctgta
gagggcactgaaacccgagtaaatgcccaggctgctgcatacgagtacatggctgcatac
atagaaaatgccaaacaggttggccgccttgagaatgcaattggttggtatcacagccac
cctggttatggctgctggctctccggaattgatgttagtacacagatgcttaaccagcag
tttcaggaaccatttgtagcagtggtgattgacccaaccagaacaatatctgcagggaag
gtgaatcttggcgcctttaggacatatccaaagggctataagcctcctgatgaaggacct
tcagagtaccagactatcccactcaataaaatagaagattttggcgtgcactgcaaacaa
tattatgccttagaagtctcatatttcaaatcctctttggatcgtaaactacttgagctc
ttgtggaataaatactgggtgaacaccctgagttcctctagcttgcttaccaatgctgac
tataccacaggccaggtgtttgatctgtctgagaagttagagcagtcggaagcccagctg
gggcgtgggagtttcatgttgggtttagaaacacatgaccgcaagtcagaagacaaactt
gccaaagctacgagagacagctgtaaaaccaccatagaagccatccatggactgatgtct
caggttattaaggataaactgtttaatcaaattaacgttgcttag

DBGET integrated database retrieval system