KEGG   Rattus norvegicus (rat): 312927
Entry
312927            CDS       T01003                                 

Gene name
Rb1cc1
Definition
(RefSeq) RB1-inducible coiled-coil protein 1
  KO
K17589  RB1-inducible coiled-coil protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04211  Longevity regulating pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    312927 (Rb1cc1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    312927 (Rb1cc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    312927 (Rb1cc1)
   05014 Amyotrophic lateral sclerosis
    312927 (Rb1cc1)
   05016 Huntington disease
    312927 (Rb1cc1)
   05017 Spinocerebellar ataxia
    312927 (Rb1cc1)
   05022 Pathways of neurodegeneration - multiple diseases
    312927 (Rb1cc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    312927 (Rb1cc1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312927 (Rb1cc1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    312927 (Rb1cc1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     312927 (Rb1cc1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    312927 (Rb1cc1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    312927 (Rb1cc1)
SSDB
Motif
Pfam: ATG11 ATG17_like TBK1_ULD ubiquitin Jag_N
Other DBs
NCBI-GeneID: 312927
NCBI-ProteinID: NP_001101371
RGD: 1309346
Ensembl: ENSRNOG00000006833
UniProt: D3ZHK4
Position
5
AA seq 1588 aa
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAVQHQVLVVNGGECMTADRRVC
TYSAGTDTNPIFLFNKEMILCDRAPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LAVEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSTSYQKLLFKFESIYSDYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRPDSLNEHEGSEKADMKRSTEL
VLSPDMPRTTNTSLLTSFHKSVEHVAPDVTDAEQGKELRESCQSTVQQEDAPVDAKDSDL
PFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPKIIQPFMLECHQTIAKLDNQNMKA
IKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQMRAENLKDASVLPDLCLSHANQLM
IMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLE
RVRIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKQLYEAEKSKRESFGKL
FRKSFLRNRLFKGLDSWPSSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPL
LCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLNEQKVSTSQASPQSAASPRIESTTG
ITTTTSPKAPPPLTVQDTLYPAACPLEELSPDSIDAHTFDFETVSHPNTEQTVHQASIDL
DSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTS
TRGNEGFGDRAALHVQLEKCRVAAQDSHISIQTIKDDLCHFRTFVQKEQCDLSNYLKCTA
VEIRNIIDKVKCSLEITLKEKHQQELQSLKIEYECKLNTLEKDSEENVNKILKLKEDLVS
LEEALQNKDSEFAIIKHEKDAIVCMQHEKDQKLLEMENIMHTQNSEIKELKQSREMVLED
LKKLHDEKIESLRAEFQCLEQNHLKELEDTLHIRHTEEFEKVITDHKVSLEKLKKENQQK
IDQMLESHASAIQEKEQQLQELKVKVSDLSDMRCKLEVELALKEAETDEIKILLEESRTQ
QKETLKSLLEQETENLRTEINKLNQKIHDNSESYQVGLSELRSLMTIEKDQCISELISRH
EEESNILKAELDSVTALHHQAFEIEKKLKEQIVELQTKLNSELSALEKQKDEKITQQEEK
YKALIQNLEKDKQRLAMNHEQDKEQLIQKLNFEKDEAIQTALDEFKLERELVEKELLEKV
KHLENQIAKSPAFESAREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSL
IAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKK
LEEEVSKLRTSSVLPSAPVLAAPELYGACAPELPGEPERSAMETTDEGRVDSAMETSMMS
VQENMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSLSSVSSRHSEKIAIRDFQVGDL
VLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGVSRRPWVLGKVMEKEYCQ
AKKAQNRFKVPLGTKFYRVKAVSWNKKV
NT seq 4767 nt   +upstreamnt  +downstreamnt
atgaagttatatgtgtttctggttaacactggaaccactctgacatttgacactgagcta
actgtgcaaactgtggctgatctgaagcatgccattcaaagcaaatacaagattgctgtt
cagcaccaggtgctagttgtcaatggaggagaatgcatgactgcagatcgaagagtgtgc
acttacagcgctgggacggacacaaatccaatttttctttttaataaagaaatgatctta
tgtgaccgtgcacctgctattcctaaaaccaccttttcaacagaaaatgacatggaaata
aaagtcgaagagtctcttatgatgcctgcagtttttcacactgtcgcttcaaggacacag
cttgcagtggaaatgtatgaagttgccaagaagctttgctctttctgtgaaggccttgtc
catgatgaacatcttcagcaccaaggctgggctgcaatcatggccaatctggaggactgt
tcaacttcataccaaaaactccttttcaagtttgaaagtatttattctgattatctgcaa
tccatagaagacatcaagttaaaacttactcatttaggaactgcggtttcagtaatggcc
aagattccactgttggagtgcctaaccagacatagttacagggaatgtttgggaagaccg
gattctttaaatgaacatgaaggctcagagaaagctgatatgaaaagatctactgaactg
gtgctctctcctgatatgcctagaacaactaacacatccttgttaacctcatttcacaag
tcagtggagcatgtagctccagatgtcactgatgctgaacaaggcaaagaacttcgagaa
tcttgtcaaagtactgtccagcaagaagacgctccagtagatgctaaagacagtgatctg
cctttttttaatgtttctttgttagactggataaatgttcaagatagacctaatgatgtg
gaatctctggtcaggaagtgctttgattctatgagcaggcttgacccaaagattattcaa
ccgtttatgttagaatgccatcaaactattgccaaacttgataatcagaatatgaaagcc
attaaaggacttgaagatcggctgtatgccttggaccagatgattgctagctgtagcagg
ctggtgaatgaacagaaagagcttgctcagggatttttagctaatcagatgagagcagaa
aacttgaaggatgcatctgtgctacctgatctgtgcctgagtcatgcaaatcagctaatg
attatgttgcaaaaccacagaaaactgttggacattaaacagaagtgtaccactgccaaa
caagagctagcaaacaatctgcatgtcagactgaagtggtgttgttttgtgatgcttcat
gctgatcaagatggagaaaaactgcaagcactactccgccttgtaatagagctattagaa
agagtcagaattgttgaggctcttagtacagttcctcagatgtactgcctagctgttgtt
gaggttgtaaggagaaaaatgttcattaaacactacagagagtgggccggtgctttagtc
aaagatggaaaacaattgtatgaagctgaaaagtcaaaaagggagtcctttgggaaatta
tttaggaagtcctttttaagaaatcgtctgtttaagggactggactcctggccttcctca
ttttgtactcagaagcctcgaaaatttgactgtgaacttccagatatatcattaaaagat
ttacagtttcttcaatcattttgtccttcagaagtgcagccattcctcagggttccttta
ctttgtgactttgaacctctacaccagcatgtacttgccctacataatttggtaaaagca
gcacaaagtttggatgaaatgtcacagaccattacagatctgctgaatgaacaaaaggta
tccacaagtcaagcatctccacagtcagctgcttctccaagaatagaaagtacaacaggc
attacaactactacctcaccaaaagctcctcctccactaactgttcaggatactctatat
ccggcagcgtgtcccttagaagagctgtctccggatagcatcgatgctcacacatttgat
tttgaaaccgtctcccatccaaacacagagcaaacagttcaccaggcttctatagacttg
gactcattagcagaaagccctgagtctgattttatgtctgctgtgaatgagtttgtgata
gaagaaaatttatcatctccgaaccctataagtgatccacaaagtccagaaatgatggtg
gagtcgctttactcttcagtcatcaatgcaatagatagtaggcgcatgcaggacacaagc
acacgtggaaacgagggctttggggatcgcgctgcgctacatgtccagctcgagaaatgc
agagttgctgcccaagactctcacatcagtatacaaaccatcaaggatgatctgtgccac
ttcagaacatttgtacagaaagaacagtgtgacttatcaaattatttaaaatgtacagct
gtagaaataagaaatattattgacaaagtaaaatgttccctagaaataacactaaaggaa
aaacatcagcaagaactccaatctttaaaaattgagtatgaatgtaaacttaatactcta
gaaaaagacagtgaagaaaatgtaaataaaattttaaaattgaaagaagatttagtatcc
cttgaggaggctttacaaaataaagacagtgaatttgcgataattaagcatgaaaaggat
gctattgtctgcatgcagcatgagaaggatcagaagttgttagagatggaaaatataatg
catactcaaaacagtgaaattaaagaactgaagcagtcacgagaaatggtgttagaagac
ctgaaaaaactgcatgatgaaaaaatagagtcattgagagctgaatttcagtgcctagaa
caaaatcacttgaaggaattagaagacacactgcacatcaggcacacagaggagtttgag
aaagttataacagaccacaaagtatctttggagaaattaaaaaaggaaaatcagcaaaaa
attgaccagatgctagaatctcatgcctcagctattcaggagaaagagcagcagctgcag
gaattgaaagtcaaggtttctgacttgtcagacatgaggtgtaagttagaggttgaactt
gcactgaaggaagcagaaacagatgaaataaagatcttgctggaagagagcagaacacag
cagaaggaaacactgaagtctctacttgaacaagaaaccgaaaacttaagaacagaaata
aataaattaaaccaaaaaattcatgataatagtgagagttatcaggtgggtttatcagag
ttaagatctttaatgacaattgaaaaagatcagtgcatttcagagttaatcagtagacat
gaggaagaatctaatatacttaaggctgaattagacagtgttacagctttgcatcaccaa
gcatttgaaatagaaaaaaaactgaaagaacaaatagttgaattgcagactaaattgaac
tcagaactgagtgctcttgaaaaacagaaagatgaaaaaataacccaacaagaagagaag
tataaagctcttatacagaaccttgagaaagacaagcaaagattggccatgaaccacgaa
caagacaaagaacagttaattcagaagcttaattttgaaaaagatgaagccattcaaact
gcactagatgaatttaagctggagagagaacttgttgagaaagagttattagaaaaagtt
aaacatcttgagaatcaaatagctaaaagtcccgcctttgaatcagccagagaagattct
tcaagcttagttgctgaacttcaagagaaacttcaggaagaaaaagctaagtttctagaa
caacttgaagaacaggagaagagaaagaatgaggaaatgcagaatgtgcgcacctctctg
attgctgaacagcagaccaattttaacacagtcttaacaagagagaaaatgagaaaagaa
aacataataaatgatcttagcgataagctaaaaagtacaatgcagcagcaagagcgggat
aaagatttgatagagtcgctgtctgaggaccgagctcgtttgcttgaagagaagaagaag
cttgaagaggaagtgagtaaactgcgcaccagcagcgtccttccctcagcacccgtgctt
gcagccccagagctttatggcgcttgtgcacctgagctcccaggtgagccagagcgatca
gccatggagacgacggacgagggaagagtggattcagcaatggagactagcatgatgtct
gtccaagaaaatatgctatctgaagagaagcagaggatcatgctcctagaacggacattg
caattgaaagaagaagaaaacaagaggttaaatcaaagattgatgtctcagagcttgtcc
tcagtatcttcaaggcattctgaaaaaatagccattagagattttcaggtgggagatttg
gttctcatcatcctagatgagcggcatgacaattatgtgttgtttactgttagtcctact
ttgtattttctgcattcagagtctcttcctgccctggatctcaaaccaggtgagggagct
tcaggtgtatctagaagaccctgggtccttggaaaagtaatggaaaaggaatactgtcaa
gccaaaaaggcacaaaacagatttaaagttcctttggggacaaagttttacagagtgaaa
gctgtgtcatggaataagaaagtatag

DBGET integrated database retrieval system