KEGG   Rattus norvegicus (rat): 312937
Entry
312937            CDS       T01003                                 

Gene name
Cyld
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    312937 (Cyld)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    312937 (Cyld)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    312937 (Cyld)
   04625 C-type lectin receptor signaling pathway
    312937 (Cyld)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    312937 (Cyld)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    312937 (Cyld)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    312937 (Cyld)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     312937 (Cyld)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C67
   312937 (Cyld)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    312937 (Cyld)
SSDB
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Other DBs
NCBI-GeneID: 312937
NCBI-ProteinID: NP_001017380
RGD: 1308346
Ensembl: ENSRNOG00000014048
UniProt: Q66H62
Position
19
AA seq 953 aa
MSSGLWNQEKVTSPYWEERLFYLLLQECSVTDKQTQKLLRVPKGSIGQYIQDRSVGHSRV
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRIRLS
KGLQVDVGSPVRVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTVQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTVLLHIN
DIIPDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNGSSV
DSQQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPFSL
TKMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPMPSSSGNAHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSALDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHTYHPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgagttcaggcctgtggaaccaagagaaagttacttcaccctactgggaagaacggctt
ttttatctgcttcttcaagaatgcagtgtaacagacaaacagacacagaagctcctgaga
gtacccaaagggagcataggacagtacatccaagaccgttccgtggggcattcaagagtt
ccttctgctaaaggcaagaaaaatcagattggattaaaaatcttagagcaaccgcatgca
gttctgtttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttactg
ttggcaattaccaactgtgaggagaggctcagcctatttagaaacagaatccgactaagt
aaaggcctccaggtagacgtgggcagtcctgtgagagtacagctgcgatctggggaggag
aagtttccaggagttgtacgcttcagaggacctttattagcggagaggacggtgtcgggg
attttctttggagtagaattactggaagaaggtcgtggccaaggtttcactgatggggtg
tatcaaggaaaacagctcttccagtgtgatgaggactgtggcgtttttgttgcattggac
aagctggagcttatagaagatgatgacaatgggttggaaagtgattttgcaggcccagga
gatacagtccaggttgaacctccccctttggaaataaactccagagtttctttgaaggtt
ggagaaagtacagaatctggaacagtgatattctgtgatgttttaccaggaaaagagagt
ctaggatattttgttggtgtggacatggataaccctattggcaactgggacggaaggttt
gatggggttcagctttgcagttttgcaagtgttgagagtacagttctcctacacatcaat
gacatcatcccagatagcgtgacacaggaaaggagacctcccaaacttgcctttatgtca
agaggtgtaggtgacaaaggttcatctagtcataataaaccaaaggttacaggatctacc
tcagaccctggaagtagaaacagatctgaattattttataccttaaatgggtcatctgtt
gactcacaacaacaatccaagtccaaaaacccatggtacattgatgaagttgcagaagac
cctgcaaagtcacttacagagatgtcttcagacttcggacattcatcgcctccaccgcaa
cctccttccatgaactccttgtctagcgagaacagattccactccttacccttcagcctg
acaaagatgcccaacactaatggcagcatggctcacagtccactctctctgtcagtgcag
tctgtgatgggagagctgaacagcactcctgtccaggagagtccacccatgcccagctct
tctgggaatgcacacgggctagaggtgggctcactggctgaagtaaaagagaaccccccg
ttctatggggttatccgttggattggccagccaccagggctcagtgacgtgcttgctgga
ttggaactggaagatgaatgcgcaggttgtacggatggaactttcaggggcacgcgctat
ttcacctgtgccctgaagaaagcactgttcgtgaaactgaagagctgcagaccagactct
aggtttgcatccttgcagcctgtttccaatcagatcgaaaggtgtaactctttagcattt
gggggctacttaagtgaagtagtagaagaaaatacgccacctaaaatggaaaaggaaggt
ttagagataatgattggaaagaagaaaggcatccagggccattacaattcttgttactta
gactcaactttattctgcttatttgcttttagttctgccctggacactgtattacttaga
cccaaagagaagaatgatgtagagtattacagtgagactcaagagctactgaggacagag
atagtcaatcctctgagaatatatggatatgtgtgtgccacaaagattatgaagctgagg
aaaatacttgaaaaagttgaggctgcatcaggatttacctctgaggaaaaagatcctgaa
gaatttctaaacatcctgtttcatgatattttaagggttgaaccattgttaaaaataagg
tcagcaggtcaaaaagttcaagactgtaacttctatcaaatttttatggaaaaaaatgag
aaagtcggagtacccacaatccagcagttattagaatggtcttttatcaacagcaacctg
aaatttgcagaggcaccatcatgcttgattatccagatgcctcggtttgggaaagacttt
aaactatttaaaaaaatttttccttccctggaattaaatataacagatttacttgaagac
actcccaggcagtgccgcatctgtggaggactcgccatgtatgagtgtagagagtgctat
gatgacccggacatctcggcagggaagatcaagcagttctgtaagacctgcagcactcag
gttcaccttcatcccagaagactgaatcacacttaccatccagtatcacttcccaaagac
ttgcccgactgggactggagacacggctgcatcccgtgtcagaagatggagttatttgct
gtgctctgcatagaaaccagccactatgttgcttttgtgaagtacgggaaggatgactct
gcctggctcttctttgacagcatggctgatcgagatggtggtcagaatggcttcaacatt
ccacaagtgacaccctgcccagaagtaggagagtacttgaagatgtctctggaggacctg
cactctttggactccagaaggattcaaggctgtgcgcgcagacttctttgcgatgcatac
atgtgcatgtaccagagtccaaccatgagcttgtacaaataa

DBGET integrated database retrieval system