KEGG   Rattus norvegicus (rat): 312946
Entry
312946            CDS       T01003                                 

Gene name
Tmem68, RGD1309006
Definition
(RefSeq) transmembrane protein 68
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Acyltransferase DAGAT
Other DBs
NCBI-GeneID: 312946
NCBI-ProteinID: NP_001101373
RGD: 1309006
Ensembl: ENSRNOG00000008872
UniProt: D3ZF19
Position
5q12
AA seq 329 aa
MINNNQTCAAGQDSVPYVTCMLHVLEEWLGVEQLEDYLNFANHLLWVFTPLILLILPYFT
IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE
GPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPRE
KCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIRE
GFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPYDPEVTAEELAEKTKNAV
QALIDKHQRIPGNIRSALLDRFHKEQKAN
NT seq 990 nt   +upstreamnt  +downstreamnt
atgataaataacaaccagacgtgtgctgcagggcaggactccgtgccctacgtgacctgt
atgcttcacgtgctggaagagtggttgggtgtggaacagttggaggactacctgaatttt
gcgaaccatctcttgtgggtcttcaccccgctgatccttttaatacttccgtactttacc
atcttccttctctaccttactattattttcctccacatctataagaggaagaatgtgtta
aaagaagcctactctcacaacttgtgggatggcgcgaggaaaacagtggcaaccctgtgg
gatggacatgcggcggtttggcatggttatgaagttcacgggatggaaaagataccagaa
ggaccagcacttataattttttatcatggagctattcccatagacttttactacttcatg
gctaaaattttcatccacaaaggcagaacttgccgagtggtagctgaccactttgtcttt
aaaatcccagggttcagtttattacttgatgtattttgtgctcttcatggaccaagagaa
aaatgtgttgaaatcttgaggagtggtcacttgttagctatttcaccgggtggagttcga
gaagccttacttagtgatgaaacctacaacatcatatggggtaatcgtaaaggctttgct
caggttgcaatcgatgcaaaagtgcccattattcctatgtttacacaaaacatccgagaa
ggatttagatcactcggaggaacaagattgtttaaatggctttatgaaaaattccgctat
ccgtttgctccaatgtatggaggttttcctgtgaagttgcggaccttcttgggtgatcct
attccgtatgacccagaggtaacagcagaagaattagctgaaaagactaagaacgctgtt
caagctttgatcgacaagcaccaaaggataccggggaacattaggagtgctttgctggac
cgctttcataaagagcagaaggctaattga

DBGET integrated database retrieval system