KEGG   Rattus norvegicus (rat): 313017Help
Entry
313017            CDS       T01003                                 

Gene name
Sfn
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313017 (Sfn)
   04115 p53 signaling pathway
    313017 (Sfn)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    313017 (Sfn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    313017 (Sfn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   313017 (Sfn)
  Exosomal proteins of colorectal cancer cells
   313017 (Sfn)
  Exosomal proteins of bladder cancer cells
   313017 (Sfn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 SIKE
Motif
Other DBs
NCBI-GeneID: 313017
NCBI-ProteinID: XP_001065560
RGD: 1304729
Ensembl: ENSRNOG00000033153
UniProt: G3V9A3
Position
5q36
AA seq 248 aa AA seqDB search
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGEAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPEEPQS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagttggccgaacaggccgaacgctacgaa
gacatggcagctttcatgaagagtgccgtggaaaagggtgaggagctctcctgcgaggag
cggaacctgctctccgtggcctacaagaacgtggtgggcggccagagagcggcctggaga
gtcctgtccagcatcgagcagaagagcaacgaggaggggtctgaagagaagggccccgag
gtgaaagagtaccgggagaaggtagagaccgagctcagaggtgtgtgcgacaccgtgcta
ggcttgctggactcccacctcatcaaaggggctggagaggctgagagccgcgtcttctac
ctgaagatgaagggtgactactaccgctacctagctgaggtggccactggtgatgacaag
aagcgcatcatcgattctgcccggtcagcctaccaggaggccatggacatcagcaagaag
gagatgccgcccaccaaccccatacgcctgggcctggccctgaacttttccgtcttccac
tacgagatagccaacagccccgaggaggccatctcacttgccaagaccaccttcgacgag
gccatggccgatctgcacaccctcagtgaggactcctacaaggacagcaccctcatcatg
cagctgctgagagacaacctgacgctgtggacagccgacaatgctggggaagagggtggc
gaggctccagaggagccccagagctga

DBGET integrated database retrieval system