KEGG   Rattus norvegicus (rat): 313019Help
Entry
313019            CDS       T01003                                 

Gene name
Fam46b, RGD1308967
Definition
(RefSeq) family with sequence similarity 46, member B
  KO
K23033  terminal nucleotidyltransferase 5A/B [EC:2.7.7.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    313019 (Fam46b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     313019 (Fam46b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    313019 (Fam46b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transf_7
Motif
Other DBs
NCBI-GeneID: 313019
NCBI-ProteinID: NP_001101377
RGD: 1308967
Ensembl: ENSRNOG00000056153
UniProt: B0BNK8
Position
5q36
AA seq 427 aa AA seqDB search
MMPSESGDESLEQPAAQVGTGAASAVATAGAAGGGPDLEASSASLGRHQSRLSWPQVKRL
DALLKEPIPIHGRGNFPTLSVQPQQIVQVVRSSLEEQGLHVHSVRLHGSAASHVLHPESG
LGYKDLDLVFQMDLQSEASFQLTKAVVLACLLDFLPAGVSRAKITPLTLKEAYVQKLVKV
CTDLDRWSLISLSNKSGKNVELKFVDSVRRQFEFSIDSFQIILDSLLLFGQCSSTPMSEA
FHPTVTGESLYGDFAEALEHLQHRVIATRSPEEIRGGGLLKYCHLLVRGFRPRPSTDVRA
LQRYMCSRFFIDFPDPVEQRRILERYLEAHFGGAEAARRYACLVTLHRVVNESTVCLMSH
ERRQTLDLITMLALQALAEQGPAAMAALAWRRPGSDGVVPATVNYYVTPMQPLLPRAHSY
PTWLPCN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtcggagagtggagatgagagcctggagcagccagctgcgcaggtggggacc
ggtgcagcctcggcagtggccacggctggggcggccggcggcggcccggacctggaggcc
tcctcggcctctctgggacggcaccagagccgactgagctggccacaggtgaagcggctg
gacgcgctgctcaaagagcccatccccattcacgggcgaggcaacttccccacgctgagc
gtgcaaccccagcagattgtacaggtagttcgcagtagcttggaagaacagggactgcat
gtccatagcgtgcgcttgcacggctcagctgcgagccacgtgctgcacccggagagtggc
ctaggctacaaggacctggacctggtgttccagatggacctgcagagtgaggcatccttc
cagctgaccaaggctgtggtcctggcttgcctgctggacttcctgcctgcgggagtgagc
cgggccaagataacgccgctgacactcaaggaggcctatgtgcagaaactggtgaaagtg
tgcacagacctggaccgctggagcctcatctcactgtccaacaagagcggcaagaatgtg
gaactcaagttcgtggactccgtgaggcgccagttcgaattcagcatcgactcctttcag
atcatcctggactcgctgctcctctttggccagtgctcatccacaccaatgtcggaggcc
ttccaccctacggtgactggtgagagcctgtatggggacttcgcggaggccttggagcac
ctgcagcaccgcgtcattgccacacgcagccccgaggagatccgaggtggcggcctcctc
aaatactgccacctcctggtacggggtttccggccaaggcccagcactgatgttcgcgcc
ctacagagatatatgtgttcccgtttcttcatcgactttccagacccggtggaacagagg
cgcattctggagcgctacctggaggcccacttcggcggagcagaagcagcccgccggtat
gcttgccttgtgacactgcaccgggtggtcaacgagagcacagtgtgcctcatgagccac
gagcgccgccagaccctggaccttattaccatgctagccctccaggcactagcggagcag
ggccctgctgccatggctgccctggcctggcgacgtcctggctcagatggggttgtacca
gccaccgttaattactatgtgacccccatgcagcctctgctgccccgcgctcactcctat
cctacctggctgccttgcaactga

DBGET integrated database retrieval system