KEGG   Rattus norvegicus (rat): 313021
Entry
313021            CDS       T01003                                 

Gene name
Tmem222, RGD1304793
Definition
(RefSeq) transmembrane protein 222
  KO
K20726  transmembrane protein 222
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF778
Other DBs
NCBI-GeneID: 313021
NCBI-ProteinID: NP_001107252
RGD: 1304793
Ensembl: ENSRNOG00000008564
UniProt: B0BNM0
Position
5q36
AA seq 208 aa
MAEAEGSSPLLLQPPPPPPRMAEVETPTAAETDMKQYHGSGGVVMDVERSRFPYCVVWTP
IPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKFWKLDPGQVYASGPNA
WDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLIYGKYVS
VGAFVKTWLPFVLLLGIILTISLVFNLR
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcggaagcggaagggagttctccgctcctcttacagccgccgccgccccctcctcgg
atggcggaagtagagacgccgacggcggccgagacggacatgaagcagtaccacgggtcc
ggtggagtcgtcatggacgtggagcggagccgcttcccctactgcgtggtatggacaccc
atcccggtgctcacgtggtttttccccatcattggtcacatgggcatctgcacatccaca
ggagtcattcgggacttcgctggcccctattttgtttcggaagacaacatggcctttgga
aagcctgccaagttctggaaattggaccctggacaggtatacgctagtgggcccaacgcg
tgggacacagctgtgcacgatgcctccgaagagtacaagcaccgcatgcacaatctctgc
tgtgacaactgccactcacacgtggctttggccctgaacctgatgcgttacaacaacagc
accaactggaacatggtgacgctttgcttcttctgcctgatttatgggaagtatgtcagt
gttggagccttcgtgaagacctggctgcccttcgtccttctcctgggcattatcctgacc
atcagtctcgtcttcaatctgcggtga

DBGET integrated database retrieval system