KEGG   Rattus norvegicus (rat): 313047
Entry
313047            CDS       T01003                                 

Gene name
Yars1
Definition
(RefSeq) tyrosine--tRNA ligase, cytoplasmic
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    313047 (Yars1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    313047 (Yars1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    313047 (Yars1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    313047 (Yars1)
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     313047 (Yars1)
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   313047 (Yars1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    313047 (Yars1)
 Prokaryotic type
    313047 (Yars1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    313047 (Yars1)
SSDB
Motif
Pfam: tRNA-synt_1b tRNA_bind
Other DBs
NCBI-GeneID: 313047
NCBI-ProteinID: NP_001020867
RGD: 1307616
Ensembl: ENSRNOG00000007213
UniProt: Q4KM49 A0A0H2UHG0
Position
5
AA seq 564 aa
MQPDGTSVTVPGTRRRRRTRKGRGCRLSAGNRESGAMGDAPSPEEKLHLITRNLQEVLGE
EKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMK
APWELLELRTSYYENVIKAMLESIGVPLEKLKFTKGTDYQLSKEYTLDVYRLSSLVTQHD
AKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPTLGY
SKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFV
KHVLFPLKSEFVILRDEKWGGNKTYTIYQELEKDFAAEVVHPGDLKNSVEVALNKLLDPI
REKFNTPALKKLASAAYPDPSKQKPTAKGPAKSSEPEEIIPSRLDIRVGKILSVEKHPDA
DSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCAS
VEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQ
WKQTNFMTKLGFVSCKSLKGGNIS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcaacctgacgggactagcgtgacagttcccggcacgcggagacggcggcgaacgagg
aaagggcgcgggtgccggctgagcgcgggaaaccgagagagcggagccatgggggatgct
ccaagccctgaggagaagctacaccttatcacccggaacctgcaggaggttctgggggaa
gagaagctgaaggagatactgaaggagcgggaacttaaagtttactggggcacggctacc
accgggaagccacacgtggcctactttgtacccatgtccaagattgctgacttcttgaag
gcagggtgtgaggtaaccatcctgtttgcagaccttcatgcatacctggacaacatgaaa
gctccctgggaacttctagaacttcgaaccagttactacgaaaatgtgatcaaggcaatg
ctggagagtattggtgtgcccttggagaagctcaagtttaccaaaggcaccgactaccag
ctcagcaaagagtacacactggatgtgtaccggctgtcctccctggtcacacaacatgat
gccaagaaagccggggctgaggtcgtaaagcaggtggagcaccctttgctgagtggtctg
ttgtatcccggtctgcaggccttagacgaagagtacttaaaagtagatgcccagtttggc
ggtattgatcagaggaagatttttacctttgcagagaagtatctccccacacttggctac
tcaaaacgggtccatctgatgaaccccatggttcctgggttaactgggagcaaaatgagc
tcatcagaagaggagtccaaaatcgacctccttgatcggaaggaggatgtgaagaaaaag
ctgaagaaggccttctgtgagcccggcaacgtggagaacaatggggtgctgtccttcgtc
aagcacgtcctctttcctctcaagtctgagtttgtgatcctgagagatgagaagtggggt
ggaaacaaaacctacaccatttaccaggagctggaaaaggactttgctgctgaggttgta
caccctggagacctaaagaattctgttgaagtcgccctgaacaagttgctggaccccatt
cgagaaaagtttaataccccagccctgaagaagctggccagtgctgcctaccctgatcct
tcaaagcagaagcctactgccaaaggccctgccaagagttcagaaccagaggagatcatc
ccatcccggctggacatccgtgtgggcaaaatcctcagcgtggaaaagcacccagatgca
gatagcctgtatgtggagaagattgatgtgggggaagccgaacccaggactgtggtgagc
ggcctcgtgcagtttgtgcccaaagaagaactacaggaccgactggtggtggtgctgtgc
aacctgaaaccccagaagatgagaggagtggactcccagggcatgctactgtgtgcttct
gtagaaggggtaagccgccaggtggaacctctggaccctcctgcaggctctgcccctggt
gaacgggtatttgtacagggctatgagaagggccaacctgacgaggagctcaagcccaag
aagaaagtctttgagaagctgcaggccgactttaagatttctgatgactgcgtcgcacag
tggaagcaaaccaacttcatgaccaagctgggctttgtctcctgtaaatcactaaaaggg
ggcaacatcagctag

DBGET integrated database retrieval system