KEGG   Rattus norvegicus (rat): 313126Help
Entry
313126            CDS       T01003                                 

Gene name
Gja10, Cx-57, Cx57, RGD1309630
Definition
(RefSeq) gap junction protein, alpha 10
  KO
K07631  gap junction alpha-10 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    313126 (Gja10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin
Motif
Other DBs
NCBI-GeneID: 313126
NCBI-ProteinID: NP_001166979
RGD: 1309630
Ensembl: ENSRNOG00000006478
UniProt: F1LPI3
Position
5q21
AA seq 506 aa AA seqDB search
MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQSSFACNTQQPG
CSNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRDFEKQRQKKKLYLKAQMEN
PDLDLEEQQRVERELRRLEEQKRIQKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYILYG
FQMHPIYKCTQAPCPNAVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMR
ALDGKSSSGNTENETGPPFHSTNYSGAQQCMVCSSLPERVSLLQANNKQQVIRVNIPRSK
SVWQIPHPRQLEVDVSCGKRGWAERVENSEQLHVHSPCPHERSARIQHPGQQPCHSIVCP
KNVMSQSWLGTMTASQHRPSSALETWERSQGPEVSGKPLTDRQSHFQGSDGSARESGVWT
DRLGPGSRKASFLSRLISEKGQQHSDSGSSRSLNSSCLDFPHGENSPSPLPSATGHRASM
VSKSSHVDSPSVSSPFIICGTYVYVY
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggagattggaatttactgggtggcatcctagaggaagtccactcccactccactata
gtggggaaaatctggctgactatcctcttcatcttccgaatgctggtacttggtgttgct
gctgaggatgtctgggatgacgagcagtcctcctttgcctgcaacacccagcagcctggt
tgcagcaatatctgttatgatgatgctttccctatctctctgatcagattctgggttttg
cagatcatctttgtgtcttccccttctttggtgtatatgggccatgcactctatagactc
agggactttgagaaacaaaggcagaagaagaagttatacctcaaagcccagatggagaac
ccagatcttgacttggaggagcaacaaagggttgagagggagctgaggagactcgaggag
cagaagaggattcaaaaagtccctctgaaagggtgtctcctgcgcacctacgtcttacac
atcttgaccagatctgtgctagaggtagggttcatgataggccaatatattctctatggg
ttccaaatgcaccctatttacaagtgcacacaagccccttgccccaacgcagtggactgc
tttgtatccaggcccacagagaagaccattttcatgctctttatgcacagcattgcagcc
atctccttgttactcaatattctggagatatttcatctcggcatcaggaagatcatgagg
gcactcgatggcaaatccagcagtgggaacactgagaatgaaacaggccctccgttccat
tcaaccaactactcaggggcccagcagtgtatggtttgttcttctttacctgaaagagtc
tcactacttcaagccaacaataaacagcaagtcatccgtgtcaacataccaaggtctaaa
agcgtgtggcaaattccacatcccaggcaacttgaggtagatgtttcctgtggcaaaaga
ggctgggctgagagagttgagaacagtgaacagctccatgtccatagtccatgtccacat
gagcgcagcgccagaattcagcacccgggacagcaaccatgccattccatcgtttgcccc
aagaatgtaatgtctcagtcctggttaggtacaatgacagcttctcaacaccgtccatca
tctgcgttagaaacctgggagcgatcccagggcccagaagtttcagggaaacctctcaca
gatcgccagagtcacttccaaggcagcgatggcagtgcaagagagagtggggtatggaca
gacagattaggcccaggtagtcgcaaggccagctttctatcgaggctgatatcagaaaag
ggacaacagcatagtgactcaggaagctcgaggtctctgaatagctcctgcttggatttt
ccacatggggaaaacagcccatcacctctgccatcagccactgggcacagagcatcgatg
gtaagtaaaagcagccatgttgattcaccctctgtctcttctccttttatcatatgtggg
acatatgtatatgtgtattaa

DBGET integrated database retrieval system