KEGG   Rattus norvegicus (rat): 313155
Entry
313155            CDS       T01003                                 

Gene name
RGD1359108
Definition
(RefSeq) guanine nucleotide exchange C9orf72 homolog
  KO
K23609  guanine nucleotide exchange protein C9orf72
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    313155 (RGD1359108)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    313155 (RGD1359108)
   05022 Pathways of neurodegeneration - multiple diseases
    313155 (RGD1359108)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    313155 (RGD1359108)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Rab associated proteins
    313155 (RGD1359108)
SSDB
Motif
Pfam: C9orf72-like
Other DBs
NCBI-GeneID: 313155
NCBI-ProteinID: NP_001007703
RGD: 1359108
Ensembl: ENSRNOG00000009478
UniProt: Q66HC3
Position
5
AA seq 481 aa
MSTICPPPSPAVAKTEIALSGESPLLAATFAYWDNILGPRVRHIWAPKTDQVLLSDGEIT
FLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTE
LSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIVLEGTERMEDQGQSIIPMLTGEV
IPVMELLASMRSHSVPEDLDIADTVLNDDDIGDSCHEGFLLNAISSHLQTCGCSVVVGSS
AEKVNKIVRTLCLFLTPAERKCSRLCEAESSFKYESGLFVQGLLKDATGSFVLPFRQVMY
APYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQDTIIYTDESF
TPDLNIFQDVLHRDTLVKAFLDQVFHLKPGLSLRSTFLAQFLLILHRKALTLIKYIEDDT
QKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKIKPGLHSFIFGRPFYTSVQERDVLMT
F
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtcgactatctgccccccaccatctcctgctgttgccaagacagagattgctttaagt
ggtgaatcacccttgttggcggctacctttgcttactgggataatattcttggtcctaga
gtaaggcacatttgggctccaaagacagaccaagtactcctcagtgatggagaaatcact
tttcttgccaaccacactctgaatggagaaattcttcggaatgcggagagtggggcaata
gatgtaaagttttttgtcttatctgaaaagggcgtcattattgtttcattaatcttcgac
gggaactggaacggagatcggagcacttacggactatcaattatactgccgcagacggag
ctgagtttctacctcccactgcacagagtgtgtgttgacaggctaacgcacatcattcga
aaaggaaggatatggatgcacaaggaaagacaagaaaatgtccagaaaattgtcttggaa
ggcaccgagaggatggaagatcagggtcagagtatcatccctatgcttactggggaggtc
atccctgtgatggagctgcttgcgtctatgagatcacacagtgttcctgaagacctcgat
atagctgatacagtactcaatgatgatgacattggtgacagctgtcatgaaggctttctt
ctcaatgccatcagctcacatctgcagacctgcggctgttctgtggtggtaggcagcagt
gcagagaaagtaaataagatagtaagaacactgtgcctttttctgacaccagcagagagg
aagtgctccaggctgtgtgaagccgaatcgtcctttaaatacgaatctggactctttgta
caaggcttgctaaaggatgcgactggcagttttgtactacctttccggcaagttatgtat
gccccttatcccaccacacacatcgatgtggatgtcaacactgtcaagcagatgccaccg
tgtcatgaacatatttataatcaacgcagatacatgaggtcagagctgacagccttctgg
agggcaacttcagaagaggacatggctcaggacaccatcatctacacagatgagagcttc
actcctgatttgaatattttccaagatgtcttacacagagacactctagtgaaagccttt
ctggatcaggtcttccatttgaagcctggcctgtctctcaggagtactttccttgcacag
ttcctcctcattcttcacagaaaagccttgacactaatcaagtacatagaggatgacacg
cagaaggggaaaaagccctttaagtctcttcggaacctgaagatagatcttgatttaaca
gcagagggcgaccttaacataataatggctctagctgagaaaattaagccaggcctacac
tctttcatcttcgggagacctttctacactagtgtccaagaacgtgatgttctaatgact
ttttaa

DBGET integrated database retrieval system