KEGG   Rattus norvegicus (rat): 313166
Entry
313166            CDS       T01003                                 

Gene name
Nfx1
Definition
(RefSeq) nuclear transcription factor, X-box binding 1
  KO
K12236  transcriptional repressor NF-X1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    313166 (Nfx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    313166 (Nfx1)
   04121 Ubiquitin system [BR:rno04121]
    313166 (Nfx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other zinc fingers
    313166 (Nfx1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    313166 (Nfx1)
SSDB
Motif
Pfam: R3H zf-NF-X1
Other DBs
NCBI-GeneID: 313166
NCBI-ProteinID: NP_001019955
RGD: 1310277
Ensembl: ENSRNOG00000009015
UniProt: D4AE50
Position
5q22
AA seq 1114 aa
MAEAPPVSGTFKFNTDAAEFIPQERKNSGLNCGTQRRLDSNRIGRRNYSSSPPCHLPRHI
PYDDVSAVHQHGYASGSKPKSPQGFFQSSNKSLKNHGLQNQPWQKLRNEKHQNRIKKAQG
LTEQTSDTSSLESVARSESGTNPREHSPSESEKEVVIADPRGAKPKKATQLTYNYGRGPK
AKGRLRSEWGNRMSPKSEDENARPVAISHSDSSEASCRKPVVDPCVCRRSEQRRYPQKRP
PWEVEGARPRPGRNPPKQESQRHINAGPKNNMPPLPKDNLRERPTKSACDTGNLAVVTKS
SRRVDQEKNAGRRQDPQVLSPFPRGKQNHMLKNVETHTGSLIEQLTTEKYECMVCCELVQ
VTAPVWSCQSCFHVFHLNCIKKWARSPASHADGQSGWRCPACQNVSAHVPSTYTCFCGKV
KNPEWSRNEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTRHTV
RCGQPVSVHCSNVCENILNCGQHRCAELCHAGQCQPCRIILNQVCYCGSTSRDVLCGTDV
GKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPCQPCPRLPHLVRYCPCGQTPLSQLLE
HGSNGRKTCMDPVPSCGKVCGKPLSCGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFR
TKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRC
EEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARIHECDHPVYHSC
HSEEKCPPCTFLTQKWCMGKHELRSNIPCHLVDISCGLPCSAMLPCGMHKCQRLCHKGEC
LVDEACKQPCTTPRADCGHPCMAPCHPSLPCPVTACKAKVELQCECGRRKEMVICSEASG
TYQRIAAISMASKITDMQLGDSVEISKFITKKEVQQARLQCDEECAALERKKRLAEAFDI
TDDSDPFNVRSSASKFSDSLKDDARKDFKFVSDIEKEMEALVEAVNKGKSNKKSYCFPPM
NRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSICPPTTLTSVIERETQTRPPP
PIPHHRHQADKNPGSSNLQKIVKEPVIDYFDVQD
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggcggaggcgcctccggtctcaggcacttttaaatttaatacagatgctgctgagttc
attccgcaggagagaaaaaattctggtctaaattgtgggacccaaagaagactagattct
aataggattggcagaagaaattatagttcctcacctccctgccaccttcctagacacatc
ccttacgatgatgtctctgctgttcaccagcacggttatgcctccggaagcaagcctaag
agtccacagggttttttccagtcatctaataaatcactcaagaaccatgggcttcagaat
cagccatggcagaaattaaggaatgaaaagcaccaaaacagaatcaagaaagcacaaggg
ctcactgagcagacgtcagatacatccagtttagaaagcgtagccagatccgagagtgga
acaaaccctagagaacacagcccttctgagagcgagaaggaggtagttattgcagatccc
aggggagcgaaacccaaaaaagccacgcagcttacatacaactatggccgagggccaaag
gccaaagggagactcagaagcgagtggggtaacagaatgagcccaaagtctgaggatgaa
aatgccagacctgtggccatttcccactctgactcttcagaagcctcctgtagaaaacct
gtagtggatccatgtgtgtgcagacggagtgagcagagaagatatccccagaaaaggcct
ccctgggaagtagagggggccagaccacggccaggcaggaacccaccgaaacaggagagt
cagcggcatataaatgcagggcccaaaaacaacatgcccccccttccaaaggataatctc
agagagaggccaacgaagtcagcctgtgacactgggaatttggcagttgtcaccaagtct
tccagaagagttgaccaagagaaaaatgctggaaggagacaggatcctcaagtgctgtct
ccttttcccagaggcaagcagaaccatatgctgaagaatgtggaaactcatacaggttcc
ctgattgagcagctaactacagaaaagtacgagtgtatggtgtgctgcgagttggttcag
gtcacagccccggtgtggagctgccagagctgtttccatgtctttcatctgaactgcatc
aagaaatgggctcgctctccagcgtcccacgcagatggccagagtggttggaggtgcccc
gcttgtcagaatgtttctgcacatgttcccagtacctacacttgtttctgtggcaaagta
aagaaccctgaatggagcagaaatgaaattccgcacagttgtggtgaagtttgtagaaag
aaacagcctggccaggactgtccacattcctgtaatcttctctgccatcctggaccctgc
ccaccctgccctgcttttacaactaaaacatgtgaatgtggacggaccaggcacacggtt
cgctgtggtcagcctgtctcagtccactgttctaatgtgtgtgagaatattttgaactgt
ggtcagcaccgctgtgctgagctgtgccatgcgggtcagtgccagccttgccggatcata
ttgaaccaggtgtgctactgtggcagcacctcccgagatgtgttgtgtggaaccgatgtg
ggcaagtctgatggatttggggacttcagctgtttaaagatatgtggcaaggacttgaaa
tgtgggagccatacctgttctcaggtttgccaccctcagccctgtcagccttgcccaagg
ctcccccatttggtgcgatattgcccttgcggccaaacacctctcagccagttgctggaa
catggaagtaatggtcggaagacgtgcatggatcctgttccttcctgtggaaaagtgtgt
ggcaaacccttgtcctgtgggtcctcagatttcatccacacctgtgaaaagctctgccat
gagggagactgtgggccgtgctcgcgcacatcagtcatttcctgcagatgctccttcaga
acaaaggagctcccgtgtaccagtcttaaaagtgaagatgctacattcatgtgtgacaag
cggtgtaacaagaaacgattgtgtggacggcataaatgtaacgagatctgctgtgtggac
aaggagcacaagtgtcctttgatttgtgggaggaaactccgttgtggccttcatcggtgt
gaagaaccttgtcaccgagggaactgtcagacctgctggcaagccagctttgatgaatta
acctgccattgtggcgcctctgtgatctacccaccagttccctgtgggactaggcctcct
gagtgtacccagacctgtgcgaggatccatgaatgtgaccatccagtatatcattcttgt
catagtgaggagaagtgtcccccttgtactttcctaactcagaagtggtgcatgggcaag
catgagttacgaagcaacatcccctgtcacctggttgatatctcttgcggattaccctgc
agtgccatgctaccctgtgggatgcacaaatgtcaaagactctgtcacaaaggagaatgt
cttgtggatgaggcctgcaagcagccctgtaccacacccagagctgactgtggccaccca
tgtatggctccctgccaccccagtttaccctgccctgtgacagcttgtaaagccaaggta
gagttacagtgtgaatgtggaagaagaaaggagatggtgatttgctctgaagcatccggg
acttatcaaaggatagctgccatttcgatggcctctaaaataacggacatgcagcttgga
gactcagtggagatcagcaagttcattaccaagaaggaagtccaacaagccaggttgcag
tgtgatgaggagtgtgctgccctggaaaggaaaaagagattggcagaggcattcgacatc
actgatgactctgatcctttcaacgtacgctcttcagcatcgaaattcagtgacagcctg
aaagacgatgccaggaaagacttcaagtttgtcagtgacatcgagaaggaaatggaagcg
cttgtggaggccgtgaataagggaaagagtaataagaaaagctactgcttccctcccatg
aacagagaccaccgccgcatcatccatgacctagcccaggtttatggcctggagagtgtg
agctatgacagtgaaccaaagcgcaatgtcgtggtcactgccatcagagggaagtccatc
tgtcctcctaccacgctgaccagtgttattgaaagggagacacagacacggcctccacca
ccaattcctcatcaccgacaccaagcagacaagaatcctgggagcagtaatttacagaag
atcgtgaaggagcctgtgattgactactttgacgtccaggactga

DBGET integrated database retrieval system