KEGG   Rattus norvegicus (rat): 313173Help
Entry
313173            CDS       T01003                                 

Gene name
Cntfr
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    313173 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    313173 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    313173 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    313173 (Cntfr)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL6/12 receptor family
   313173 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  313173 (Cntfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Ig_3 ig Ig_2 Ig_5
Motif
Other DBs
NCBI-GeneID: 313173
NCBI-ProteinID: NP_001003929
RGD: 1303100
Ensembl: ENSRNOG00000047307
UniProt: Q08406
Position
5q22
AA seq 372 aa AA seqDB search
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGTDVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLSAPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSNGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELSSGGGPSIPFLTSVPVTLVL
AAAAATANNLLI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctgtcccttgggcctgctgtgctgtgcttgccgctgccgctgccgctgtc
tacacccagaaacacagtccacaggaggcaccccatgttcagtatgagcgtctgggcaca
gatgtgacgctgccatgtgggacagcaagttgggacgcagctgtgacctggagggtaaat
ggaacagatctggcccctgacctgctcaatggctctcagctgatactacgaagcttagaa
ctgggccacagtggcctgtatgcctgtttccaccgtgactcctggcacctgcgccaccaa
gtccttctgcatgtgggtttgccgcctcgggaacccgtgctcagctgccgttccaacact
taccccaagggcttctactgcagctggcacctgtccgcccccacctacatccccaatacc
ttcaatgtgactgtactgcatggctccaaaatgatggtctgtgagaaggacccagccctc
aagaaccgctgtcacattcggtacatgcacctgttctcaaccatcaagtacaaggtctcc
ataagtgtcagcaacgccttgggtcacaacaccacggctatcaccttcgacgaattcacc
attgtgaagcccgatcctccagaaaatgtggtggcccggccagtgcccagcaacccccgt
cgactggaggtgacatggcagaccccctcaacttggcctgatcccgaatcctttccactc
aagttttttctgcgctaccggcctctcatcctggatcaatggcagcatgtggagctctcg
aatggcacagcccacaccatcacggatgcctatgctgggaaggagtacatcatccaggtg
gccgccaaggacaatgagattgggacatggagtgactggagtgtggctgctcacgccaca
ccctggactgaggaaccacggcatctcaccactgaagcccaggcccccgagaccacgacc
agcaccaccagctccttggcacccccacccaccacgaagatctgtgaccccggggagctc
agcagcggcggaggaccctccatacccttcttgaccagtgtccctgtcactctggtcctg
gctgccgctgctgccacagccaacaatctcctgatctga

DBGET integrated database retrieval system