KEGG   Rattus norvegicus (rat): 313210Help
Entry
313210            CDS       T01003                                 

Gene name
Abca1
Definition
(RefSeq) ATP binding cassette subfamily A member 1
  KO
K05641  ATP-binding cassette, subfamily A (ABC1), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04975  Fat digestion and absorption
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    313210 (Abca1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    313210 (Abca1)
   04979 Cholesterol metabolism
    313210 (Abca1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    313210 (Abca1)
Transporters [BR:rno02000]
 ABC Transporters, Eukaryotic Type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    313210 (Abca1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 DUF4162 AAA_23 Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 313210
NCBI-ProteinID: NP_835196
RGD: 631344
Ensembl: ENSRNOG00000018126
UniProt: Q80ZB2
Position
5q23-q24
AA seq 2201 aa AA seqDB search
MPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVSRLFSDAQRILLYSQKDT
SIRDMHKVLRTLQQIKHPNSNLKLQDFLVDNETFSGFLQHSLSLPRSAVDNLLQADVSLQ
KVFLQGYQLHLASLCNGSKLEEIIRPEDLKVSALCSLPREKLDAPERELRSNMDILKPVM
TKLNSTSLLPTQHLAEATTTLLDSLGGLAQELFSTKSWSDMRQEVMFLTNVNNSGSSTQI
YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDTDTFYDNSTTPYCNDLMK
NLESSPLSRIIWKALKPLLIGKILYTPDTPATRQVMAEVNKTFQELALFPDLEGMWEELS
PQIWTFMESSQEMDLVRPMLDLRGNDQFWERKLDGLYWTAQDIMAFLAKNPEDVQSPNGS
VYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVTLINKSMDLLDARKFSAGIDFTG
ITPDSVELPHHVKDKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVV
EQAIIRVLTGTEKKTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIV
YEKEARLKETMRIMGLDNGILWFSWFISSLIPLLVSAGLLVIILKLGDLLPYSDPSVVFV
FLSVFAVVTILQCFLISTLFSRXNLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFAS
LLSPVAFGFGCEYFALFEEQGIGVQWDNLFKSPVEEDGFNLTTSVSMMLFDTFIYGVMTW
YIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHPGSSQKGASEICMEEEPTHLKLGVS
IQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIL
GKDIRSEMNSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVG
LPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ
GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLS
SCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDI
GHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAE
TSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDLDPESRETDLLSGMDGKGSYQLK
GWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPNLELQ
PWMYNEQYTFVSNDAPEDMGTQELLNALTKDPGFGTRCMEGNPIPNTPCLVGEEDWTTGP
VPQTLMDLFQNGNWTMKNPSPSCQCSSDKIKKMLPVCPPGAGGLPPPQRKQKTADILQNL
TGRNNSDYLVKTYVQIIAKSLKNKVWVNEFRYGGFSLGVSDSQALPPSQEVNNAIKQMKK
LLKLTKDSSADRFLSSLGRFMTGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQK
GENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQER
VSKAKHLQFICGVKPVIYWLSNFVWDMCNYVVPATLVVIIFICFQQKSYVSSTNLPVLAL
LLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNNKFNDIN
DILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEG
VVFFLVTVLIQYRFFIRPRPVKARLPPLNDEDEDVRRERQRILEGGGQNDILEIKELTKI
YRRKRKPAVDRICVGIPPGECFGLLGVNGAGKTSTFKMLTGDTAVTRGDALLNKNSILSN
IHEVHQNMGYCPQFDAITELLTGREHLEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEK
YASNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIIKEGRSVVLT
SHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFG
LAFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNF
AKDQSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV
NT seq 6606 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgcaggaacccttccctgggtccaggggattatctgtaatgccaataaccct
tgcttccgttatccaactccaggcgaggctcccggtgttgttggaaactttaacaagtcc
attgtgtcccgcctattctcagatgctcaacggattcttttgtacagccaaaaggacacc
agcattagggacatgcacaaggtcctgagaacattacagcagatcaagcatcccaactca
aatttgaagcttcaggatttcctggtggacaatgaaaccttctctggattcctacagcac
agtttgtcccttccaaggtccgctgtggacaatctgctacaggctgatgtcagtctccag
aaggtgtttttgcaaggctaccagttacatttggccagtctgtgtaatggatcaaaatta
gaagaaatcattcggcctgaagatctgaaagtttctgccctttgtagtctacctagggag
aagctagatgcaccagagcgcgagctgcgttctaacatggacatcctgaagccagtcatg
acaaaactaaactccacgtctcttctcccgacccagcatctggctgaagccaccacaacg
ttgcttgacagcttaggggggctggcccaagagctcttcagcacaaagagctggagcgac
atgcggcaggaggtgatgtttctgaccaacgtgaacaactccggctcctccacccagata
taccaggctgtgtcccgaatcgtctgtggtcacccagagggcgggggcctgaagatcaag
tccctcaactggtacgaggataacaactacaaagccctctttggagggaatggcaccgag
gaagacacggacaccttctatgacaattctacaactccttattgcaatgatttgatgaag
aacttggagtctagtcctctttctcgaattatttggaaggcactcaagccactgctcatt
gggaagattctgtatacacctgacacaccagctacaaggcaggtcatggctgaggtgaac
aagacctttcaggagctggctttgttccctgacctggagggcatgtgggaagaactcagc
ccccaaatttggaccttcatggagagcagccaagagatggaccttgtgcggccgatgttg
gacctcagaggcaatgaccagttttgggaacgaaagttggatggattatattggactgcc
caagacatcatggcatttctggccaagaacccagaggatgttcagtccccaaatggctct
gtgtatacatggagagaagctttcaatgagaccaaccaggcaatccagacgatatctcga
ttcatggagtgtgtcaacctgaacaagctggagcccatcccaaccgaagtcacgctcatc
aacaagtccatggacctattggatgcgaggaagttctcggctggtatcgatttcacagga
atcactcctgatagtgtggagctgccccaccatgtaaaggacaagatccggatggacatt
gacaatgttgagagaaccaataagatcaaggatgggtactgggaccctggtccccgggct
gacccttttgaagatatgcgctatgtctggggtggcttcgcctacttgcaggatgtggtg
gagcaggcgatcatcagagtgctgacggggactgagaagaaaacgggcgtctatgtgcaa
cagatgccctacccctgttatgttgatgacatttttctgcgggtcatgagccgctcaatg
cccctcttcatgactctggcctggatctactctgtggctgtgatcatcaagagcattgtg
tatgagaaggaggctcggttgaaggagaccatgcgcatcatgggcctggacaatggcatc
ctctggtttagctggttcattagtagtctcatccctctgctcgtgagcgctggcctgttg
gtgatcatcttgaagttaggagatctgctgccctatagtgaccccagcgtggtgttcgtc
ttcctctctgtgtttgccgtggtgaccattctacagtgcttcctcattagcacactcttc
tcccggrccaacctggcagcagcctgtgggggcatcatctacttcacgctgtacctgccc
tatgtgctgtgtgtagcatggcaggactatgtgggcttctccatcaagatctttgctagc
ctgctgtctcctgtggcttttggattcggctgtgagtattttgctctttttgaggagcaa
ggcatcggggtccaatgggacaatctctttaagagcccagtggaggaggatggcttcaat
cttaccacctcagtgtccatgatgctgtttgacaccttcatctatggcgtgatgacatgg
tacatcgaagccgtcttcccaggacagtacggaattcccaggccctggtattttccttgt
accaagtcctactggtttggggaggaaattgatgagaagagccaccctggttccagccag
aagggtgcgtcagaaatctgcatggaagaggagcccactcacctgaagctgggggtatcc
attcagaacctggtgaaggtttaccgagatggcatgaaggttgctgtggatggtttggcg
ctaaatttttacgagggccagatcacctccttcctgggccacaatggagcagggaagacc
accaccatgtcaatactgactgggttgtttcccccaacttctggcactgcctacatcctg
gggaaggacattcgatctgagatgaactctatccggcagaacctgggagtctgtccccag
cataatgtgttgtttgacatgctgacagtcgaagagcacatctggttctatgcccgccta
aaggggctctcagagaagcatgtgaaagcagagatggagcagatggccctggatgttggc
ttaccccccagcaagctgaaaagcaaaacaagtcagctctctggtgggatgcagagaaag
ctgtctgtggccttggccttcgtgggtggatccaaggttgtcattctggatgagcccaca
gcaggtgtggacccatactctcgcaggggaatatgggagctcctgctgaaataccgacaa
ggccgcaccattattttgtctacacaccacatggatgaagcagacatcctaggggacaga
attgccatcatttcccatgggaagctgtgttgtgtgggctcctccctgtttttgaaaaac
cagttgggaacgggttactacctgaccctggtcaagaaagatgtggaatcgtccctcagt
tcctgcagaaacagtagcagtacagtgtcttgtctgaaaaaggaggacagtgtttctcag
agcagttctgatgctggcctgggcagcgaccatgaaagtgacacgctgaccatcgatgtc
tctgctatctccaacctcatcaggaaacatgtgtccgaagcccggctggtggaggacatt
gggcacgaactgacctatgtgctgccgtacgaagctgctaaggagggagcctttgtggag
ctcttccacgagattgatgaccgcctctcagacctgggcatctccagttacggcatctca
gagaccaccctagaagaaatattcctcaaagtggctgaagagagtggggtggatgctgag
acctcagacggtactttgccagcaagacgaaacagacgggccttcggtgacaagcagagc
tgtctgcacccatttacagaggacgatgctgtggatccgaatgactctgacctagaccca
gaatccagggagacagacctgctcagcgggatggatggcaaaggctcctaccagctaaag
ggctggaaactcacccagcagcagtttgtggccctcttgtggaaaaggctgctgattgcc
cggcggagtagaaagggtttctttgctcagattgtcctgccggctgtctttgtttgcatc
gccctggtcttcagcctgatcgtgccaccctttggcaagtaccccaacctggaacttcaa
ccctggatgtataacgagcagtatacatttgtcagtaacgatgctccagaggacatgggc
acccaggaactcctcaatgctctaaccaaagatccaggcttcgggacccgttgtatggaa
ggaaacccaatcccaaacactccttgcttggtcggggaggaggactggaccactggccca
gttccccagaccctcatggacctcttccaaaatgggaactggacgatgaagaacccctca
ccttcgtgccagtgtagcagtgacaaaatcaagaagatgctgcctgtgtgtcctccaggg
gcaggggggctgccgcctcctcagagaaaacagaagactgcagacatccttcagaatctg
accggaagaaataattcagattacctggtgaagacatatgtgcagatcatagcaaaaagc
ttaaagaataaggtctgggtgaatgagtttcggtatggcgggttttccctgggtgtcagt
gattctcaagcacttcctccgagccaagaagttaataatgctatcaagcaaatgaagaaa
ctcctgaagctgaccaaggacagctctgcagatcggttcctcagcagcttgggaaggttc
atgacaggactggacaccaaaaacaatgtcaaggtgtggttcaataacaagggctggcat
gccatcagttcattcctgaatgtcatcaacaatgccattctccgggccaacctgcagaag
ggagagaacccaagccagtatgggattactgctttcaaccatcccctgaacctcaccaag
cagcagctctcggaggtggctctgatgaccacatctgtcgacgtccttgtgtccatctgt
gtcatctttgcaatgtcctttgtgccagccagctttgttgtgttcctgatccaggagcgt
gtgagcaaagccaaacaccttcagttcatctgcggcgtgaagcctgtcatctactggctc
tccaactttgtctgggatatgtgtaattatgtggtccctgctacactggtcgttatcatc
ttcatctgcttccagcagaagtcctatgtgtcctctaccaacctgcctgttctagccctt
ctgctcttgctatatgggtggtcgatcactcctctcatgtacccagcgtcctttgtgttc
aagatccccagcactgcctatgtggtcctcaccagtgtgaacctcttcatcggcatcaat
ggtagtgtggccactttcgtcctggagctctttacaaacaataaattcaatgacatcaat
gacatcctgaaatctgtgtttcttattttcccacatttttgcctggggcgagggcttatt
gacatggtgaaaaaccaggcgatggctgatgccctggagaggtttggggagaaccgcttc
gtctctccactctcttgggacttagtaggacggaacctttttgccatggccgtggaaggg
gtggtgttcttcctcgttacggttctaatccagtaccgatttttcatcaggcccagacct
gtaaaggcgaggcttcctcctttgaatgacgaggacgaggacgtgaggagggagagacag
aggattctggagggtggaggacagaatgacatcctagagatcaaagaactgaccaagatc
tacagaaggaagcggaagcctgcagtggacagaatctgcgttggcatccctcctggagag
tgctttggactcctgggagttaatggagctgggaagacatcaacattcaagatgctgact
ggagataccgctgtgaccagaggggatgctcttcttaacaagaacagcatcttatcaaac
atccatgaagtacatcaaaacatgggctactgccctcagttcgatgccatcactgagctt
ctgactggaagagagcatctggagttctttgccctcctcaggggagtcccagaaaaagaa
gttggcaaggttggtgaatgggcaattcgaaaactgggcctcgttaagtatggagaaaaa
tacgccagcaactacagtggcggtaacaagcggaagctttccacagccattgctctgatt
ggcgggcctcctgtggtgtttctggatgaaccaaccacaggcatggaccccaaagcccgg
agattcctgtggaattgtgccctaagcattatcaaggagggaagatccgtagttcttaca
tctcatagcatggaggaatgtgaagctctttgtaccaggatggccataatggtcaatggg
aggttcaggtgcctcggcagtgtccaacatctgaaaaacaggtttggagatggttatacc
atagttgtacgaatagcgggctccaaccctgacctaaagcctgtccaggagttctttgga
cttgcctttcctggaagtgttctgaaagagaaacatcgaaacatgctacagtaccagctt
ccgtcctccttgtcatctctggccaggatattcagcattctctcccagagcaaaaagcga
ctccacatagaagactactctgtctctcagacaacacttgaccaagtattcgtgaacttt
gccaaggaccaaagtgatgatgaccacttaaaggacctgtcactacacaaaaaccagaca
gtggtggatgtggctgttctcacatccttcctgcaggacgagaaagtgaaagaaagttac
gtatga

DBGET integrated database retrieval system