KEGG   Rattus norvegicus (rat): 313219Help
Entry
313219            CDS       T01003                                 

Gene name
Zfp189
Definition
(RefSeq) zinc finger protein 189
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    313219 (Zfp189)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    313219 (Zfp189)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    313219 (Zfp189)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_6 zf_UBZ zf-C2H2_11 KRAB zf-C2H2_jaz zinc_ribbon_15 DUF3268 zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 313219
NCBI-ProteinID: NP_001101400
RGD: 1306510
Ensembl: ENSRNOG00000006972
UniProt: D3ZRX1
Position
5q22
AA seq 608 aa AA seqDB search
MASPSPPLESKEEWGYLDAAPRSLYKDVVMDSYGKLVSLDVLNRNEDEEPTVKEEIEKDI
EPQGIIVTRIKSELDQDPMGSETFELVGRLDKQRGIFLWEIPRDSLTEEQKMFRGHTNVR
KRPNSEEKCHKCEECGKRFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEHQRIH
TGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRSLVKHQRIHTGEK
PHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGERPHKC
GECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEHQRIHTGERPYQCQECG
KSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQRIHIREKTSPFKETKGSFD
PNCGLVIQQEVYPKEKSYKCDDCGKTFSVSAHLVQHQRIHTGEKPYLCTVCGKSFSRSSF
LIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHKCEECGKAFSRNSGLIQH
QRIHTGEKPYRCEKCDKSFSQQRSLVNHQKIHAEVKTQEIYECDACGEAFTCQISLIQHQ
KLHIMWMQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccaagcccaccgctggagtcaaaggaggagtggggttatctggatgcagct
ccgagaagcctgtataaagatgtcgtgatggacagttatggaaagctggtctcgctggat
gttttaaacagaaatgaagatgaagagccaactgtgaaagaagaaattgagaaagacatc
gaaccacagggtataatagttacaagaatcaaaagtgaacttgatcaggatcctatgggt
agcgaaacctttgaacttgttggtaggttagataaacaaagaggaatcttcttatgggaa
ataccacgtgattctttgactgaggaacagaaaatgttcagaggacacactaatgttcgt
aagagaccaaactctgaagagaaatgtcataaatgtgaagaatgtggaaaacgttttgtc
cgcaaggcccatttcattcagcatcaaagggtccacactggtgagaaaccttttcagtgc
aacgagtgtggaaaaagctttagtcgcagttcatttgttattgagcatcagagaattcac
actggggaacggccctatgagtgtaattactgtgggaaaacctttagtgtgagctctacc
cttattaggcaccagagaatccacactggggagaggccttaccagtgtaatcagtgtaaa
cagagcttcagccagagaaggagtcttgttaaacatcaaagaattcacactggtgagaaa
ccccataaatgtagtgactgtggaaaagccttcagttggaaatcgcatcttattgagcat
cagagaacacacactggtgagaaaccctatcactgtaccaaatgcaagaaaagctttagt
cgaaactcactgcttgttgaacaccagagaattcatactggggaaagacctcataagtgt
ggtgaatgtgggaaagcttttagattaagtacataccttatacaacaccaaaaaatacac
actggtgagaagccctttctttgtattgaatgtggcaagagtttcagtcggagctcattc
cttattgaacatcaaaggattcatactggtgaacgcccttatcagtgccaagagtgtggg
aaaagtttcagtcaactttgcaaccttactcgtcatcagagaattcacacaggagacaaa
ccccacaagtgtgaggaatgtggaaaagccttcagtagaagctcaggtctcattcagcat
cagagaatacacatcagggaaaagacttctccattcaaggaaactaagggaagttttgat
ccaaactgtggtcttgttattcagcaggaagtctaccctaaagaaaaatcttacaaatgt
gatgactgcgggaaaacgtttagtgttagtgctcatcttgtacaacatcagaggatccac
actggtgagaagccttacctgtgcaccgtctgcgggaaaagctttagtcggagctcattt
cttattgagcaccagagaatccacactggtgagagaccttatttgtgcagacaatgtggc
aaaagttttagtcaactttgtaatctcatccgacatcagggtgttcacactggtaataaa
ccccataaatgtgaagagtgtgggaaagcctttagtaggaactcaggtctcattcagcac
cagagaatacacacaggagagaaaccttataggtgtgaaaaatgtgacaaaagtttcagt
caacagcgaagccttgtcaaccatcagaagatccatgcggaagtgaaaacccaagaaatt
tatgaatgtgacgcttgcggcgaagccttcacttgtcagatttctctaattcagcatcaa
aagttacatattatgtggatgcagtaa

DBGET integrated database retrieval system