KEGG   Rattus norvegicus (rat): 313225Help
Entry
313225            CDS       T01003                                 

Gene name
Murc, RGD1310395
Definition
(RefSeq) muscle-related coiled-coil protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PTRF_SDPR DUF1664 Cas_GSU0053 CCDC23 DUF1640
Motif
Other DBs
NCBI-GeneID: 313225
NCBI-ProteinID: NP_001101401
RGD: 1310395
Ensembl: ENSRNOG00000008027
UniProt: B1PRL5
Position
5q22
AA seq 362 aa AA seqDB search
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHRE
MGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETK
QEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEE
SRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERL
RQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLA
LGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQ
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaatggatctgcttcaaatgctggtaaaatccaccagaaccgattgtcaagt
gtgactgaagatgaagaccaggacgcagctctcacaattgtgactgtgctggacagggtg
gccaccgtcgtggacagcgtgcaggcaagccagaagagaatcgaggagagacacagagag
atggggaacgccatcaagtctgtccagatagacctgctgaagctctcacaatcacacagc
aacacgggctacgttgttaacaagctgtttgagaagacccggaaagtcagcgctcacatt
aaagatgtgaaggcccgggtagagaagcaacaggttcgagtaaccaaagtcgaaaccaag
caagaagaaataatgaagaagaacaagttccgcgtggtaatcttccaggaggatgttccc
tgccccgcatccctgtctgttgttaaagacagaagcctgccggagaacgaggaggaagct
gaggaagtcttcgatcccccgatcgatctctcatcggatgaagaatactatgttgaagaa
agcagatctgccaggcttagaaagtcaggcaaagagcacatcgatcatattaagaaggca
ttttccaaagaaaacatgcagaagacgcggcagaattttgataagaaagtgagtggaatt
agaaccaggatagttacacctgagagaagagagaggctgaggcagtcaggagagaggctg
aggcagtcgggggagaggctgaggcagtcgggggaaagatttaagaaatcgatctcaaat
gccaccccctccaaggaagcttttaagatccggagccttagaaaaccgaaggaccccaag
gcagaaggccaggaggtagacagggggatgggggtggacatcatctcaggtagcctggct
ctggggcccatccatgagttccactctgatgggttcagtgaaacagaaaaggaggtgacc
aaagtagggtacattccccaagagggaggggaccccccaacgcctgagcctttgaaggtg
acctttaaacctcaggtgagagtagaggatgacgagtcactcctgttggaattaaagcag
tcctcatag

DBGET integrated database retrieval system