KEGG   Rattus norvegicus (rat): 313245
Entry
313245            CDS       T01003                                 

Gene name
Polr1e
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA49
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    313245 (Polr1e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    313245 (Polr1e)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     313245 (Polr1e)
SSDB
Motif
Pfam: RNA_pol_I_A49 CPL
Other DBs
NCBI-GeneID: 313245
NCBI-ProteinID: NP_001101408
RGD: 1565773
Ensembl: ENSRNOG00000012664
Vega: OTTRNOG00000002235
UniProt: B0BN64
Position
5
AA seq 434 aa
MATPDSPGMDGQTGDTETEVLQSARWQYCGEPDDRQKAVLVQFSNGKLQNPGNMRFTLYN
STDLVNPRQKCHRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAE
VFNMQPLFAEDSIEHGPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNSRRMNKVGSESLN
FTVAKAAESIIDTKGVSALVSDAMQDDLQNDSLYLPPCHADATKPEDVYRFEDILSPAEY
DALESPSEAFRKVMSEDILKMVEENSHCSFIIEMLKSLPADEVQRNRQARSIWFLDALLR
FRAQKVIKGKSALGPGIPHIINTKLLKQFTCLTYNNGSLRNLISSSMKAKITAYAIILAL
HINNFQIDLTVLQRDLKLSEKRMIEIARAMRLKISKRKVSLADGREEDHRLGTLSVPLPP
AQTSDRQSKRKKMS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggctacgccggattctcccgggatggatggccagactggagacacggagacagaggtg
ctacagagtgcaagatggcagtactgtggagagcccgacgacaggcagaaagctgtgctg
gtccaattctccaatgggaagctgcagaatccaggcaacatgcgcttcaccttgtacaac
agcaccgacttggtaaaccccaggcagaagtgccatcggatcctggccgctgagacagac
aggctctcctatgttggaaacaattttgggactggcgccctcaaatgcaacactctttgc
agacactttgtgggcattctgaataagacctctggccaaatggaagtctatgatgcggaa
gtattcaacatgcagcccctgtttgctgaagactctattgagcatgggcctcctctggag
aatcagaacaagaccttcagggacaagttggattcttgcattgaagcctttggaagcacc
aagcagaagcggtccctgaactcccggagaatgaacaaagttggcagcgagtctttgaat
ttcacagtagctaaagccgcagagagtatcattgacacgaagggcgtgagtgctttggtc
agcgatgccatgcaagatgacttgcaaaatgactccctctaccttcctccctgccatgct
gatgccaccaagcccgaagacgtgtatagatttgaagacatcctgtccccggccgagtat
gatgctcttgaaagcccatccgaagccttcagaaaggtcatgtctgaagacatactgaag
atggtggaagagaacagccactgctccttcatcatagaaatgctgaagtctttgccagca
gacgaggtgcagcgaaaccggcaagcccggagcatttggttcctagatgccctcctcaga
ttccgagctcagaaagtgataaaagggaaaagtgccttaggacctgggatcccgcacatc
atcaacaccaagctgctgaagcagttcacctgcttgacctacaacaacggcagtttacgg
aacttaatctcgagttctatgaaggccaagatcactgcatatgcaatcatccttgctctg
cacataaataacttccagattgatctgacggtgttacagagggacttgaagctgagtgag
aaaaggatgattgagatagcgagagccatgaggctgaagatctccaaaagaaaggtgtcc
ctggcagatggcagggaagaggatcatagactgggcactctgtccgtcccactgcctccg
gcccagacctcagaccgacagtcgaagcggaaaaaaatgagctag

DBGET integrated database retrieval system