KEGG   Rattus norvegicus (rat): 313370Help
Entry
313370            CDS       T01003                                 

Gene name
Hook1
Definition
(RefSeq) hook microtubule-tethering protein 1
  KO
K16612  protein HOOK1
Organism
rno  Rattus norvegicus (rat)
Brite
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Hook proteins
     313370 (Hook1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HOOK Spc7 TPR_MLP1_2 GAS MscS_porin HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 313370
NCBI-ProteinID: NP_001101416
RGD: 1309987
Ensembl: ENSRNOG00000026226
UniProt: D3ZB48
Position
5q33
AA seq 728 aa AA seqDB search
MEDPQPLPQPELPLCDSLIIWLQTFKTASPCQDVKQLTNGVTMAQVLHQIDVAWFSESWL
SRIKDDVGDNWRIKASNLKKVLHGITSYYHEFLGQQISEELIPDLNQITESSDPVELGRL
LQLILGCAVNCEKKQEHIKNIMTLEESVQHVVMTAIQELMSKEIVSSPASDAVGELEQQL
KRALEELQEALAEKEELKQRCQELDMQVTALQDEKNSLVSENEMMNEKLDQLDGSFDDPN
TMVAKKYFHVQLQLEQLQEENYRLEAAKDDYRVHCEELEKQLIEFQHRNDELTSLAEETR
ALKDEIDVLRATSDKANKLESTVEVYRQKLQDLNDLRKQVKSLQETNMMYMHNTVSLEEE
LKKANAARAQLETYKRQVQDLHTKLSSESKRADTLAFEMKRLEEKHETLLKEKERLIEQR
DTLKETNEELRCSKAQQDHLNQADSSATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQ
QEGTENERIEQLQEQLEQKHRKMNELETEQRLSKERIGELQQQIEDLQKSLQEQGSKSEG
ESSSKLKQKLEAHMEKLTEVHEELQKKQELIEDLQPDISQNAQKISELEAALQKKDEDMK
AMEERYKMYLEKARNVIKTLDPKLNPASAEIMLLRKQLAEKDRRIEILESECKVAKFRDY
EEKLIVSAWYNKSLAFQKLGMESRLVSGASACKDSVAAAPARSFLAQQRHITSTRRNLSV
KVPAAASD
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaggacccgcagccgctgccacagcctgagctgccgctgtgtgacagcctcatcatc
tggctgcagacatttaagactgcctcaccctgtcaagatgtcaaacagctgactaatgga
gtgaccatggcacaagttcttcatcaaattgacgtagcttggttcagcgaatcttggtta
agccgaattaaagatgatgttggagacaactggagaataaaggctagtaacctaaagaag
gtcctccatggaattacaagttactatcatgagtttttggggcagcagatttctgaagaa
cttattcctgatttaaatcaaataactgagagctcagatcctgtggagcttgggagattg
cttcagctaattctaggatgcgcagtcaactgtgagaagaaacaagaacatattaaaaat
ataatgaccctggaagaatctgttcaacatgtggtcatgactgcaattcaggagttgatg
agtaaagaaatagtgagctctcctgcaagtgacgctgtaggagaattagagcagcagcta
aaaagggctttagaagagcttcaggaggccctagcagaaaaggaagagctgaagcagagg
tgccaggaactggatatgcaggtaactgcacttcaggatgagaagaattccctggtctct
gagaatgagatgatgaatgaaaagcttgaccagttggatggctcttttgatgacccaaat
acaatggttgcaaagaagtattttcacgtacagctgcaactagaacaattacaagaagaa
aactatagacttgaagctgcaaaagatgattaccgtgttcactgtgaggaactggaaaag
cagctgattgaatttcagcacaggaacgatgagctgacgagccttgctgaggagaccaga
gccctaaaagacgagatagatgttcttagggctacctcagacaaagcaaataagctggag
tcaacagtggaggtgtatcgtcagaagctccaggacctaaatgacctccgcaagcaggtg
aaatccttacaggagacaaatatgatgtatatgcacaacactgtgagcttggaagaagag
ctgaagaaggccaatgcagctcgtgcacagctagagacctataagcgccaggttcaggac
cttcacactaagctttcctctgaatccaaaagggcagatacactagcattcgaaatgaag
aggcttgaagagaaacacgaaactttactcaaggaaaaagagcgattgatagaacagcgt
gacactctgaaagagacgaatgaggagctgcggtgctcaaaagcacaacaagatcaccta
aatcaagctgattcatctgctacaaaaagttatgaaaatcttgctgctgagatcatgcca
gtggagtacagagaggtgttcattcgactccagcatgaaaacaaaatgcttcgcctgcag
caagaagggacggagaatgagcgcatcgagcagctgcaggagcagttggaacagaaacac
cgcaagatgaacgagctggaaactgagcaaaggttgagcaaagagcgcattggagaacta
cagcagcaaattgaggacctccagaagtcgttacaagaacagggctctaagtctgaaggt
gaaagttccagcaaattaaagcagaagttggaagctcatatggaaaaactaacagaagtc
catgaagaattacagaagaaacaggagctcattgaagaccttcagccagatataagtcag
aatgcccaaaagatcagtgaacttgaagcggctcttcagaagaaagatgaagacatgaaa
gcgatggaggagagatacaaaatgtacttagagaaagccaggaatgtcattaaaacttta
gatcccaaattaaatccagcatcagcagaaataatgttactgagaaagcagctggcggag
aaggacagaagaattgaaattctagagagtgaatgtaaagtggcaaaattcagggattat
gaggaaaaactcattgtttctgcctggtataacaagagcctggcctttcagaaactgggc
atggaatctcggctggtgagcggtgctagtgcttgcaaagacagcgtcgcggctgctccc
gcgcgctccttcttagcacagcagcggcacatcaccagcacccgaagaaacctctctgtg
aaagtcccagctgcggcgtctgactag

DBGET integrated database retrieval system