KEGG   Rattus norvegicus (rat): 313375Help
Entry
313375            CDS       T01003                                 

Gene name
Cyp2j3, Cyp2j9
Definition
(RefSeq) cytochrome P450, family 2, subfamily j, polypeptide 3
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    313375 (Cyp2j3)
   00591 Linoleic acid metabolism
    313375 (Cyp2j3)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian Steroidogenesis
    313375 (Cyp2j3)
  09156 Nervous system
   04726 Serotonergic synapse
    313375 (Cyp2j3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    313375 (Cyp2j3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    313375 (Cyp2j3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     313375 (Cyp2j3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   313375 (Cyp2j3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 313375
NCBI-ProteinID: NP_786942
RGD: 631442
UniProt: P51590
Position
5q33
AA seq 502 aa AA seqDB search
MLVTAGSLLGAIWTVLHLRILLLAAVTFLFLADFLKHRRPKNYPPGPWRLPLVGCLFHLD
PKQPHLSLQQFVKKYGNVLSLDFANIPSVVVTGMPLIKEIFTQMEHNFLNRPVTLLRKHL
FNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLVEAIKDEGGLPFDP
HFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYL
PGSHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFLKEMAKYPDKTTTSFNEEN
LICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQGRQPNLADRDSMP
YTNAVIHEVQRIGNIIPFNVPREVAVDTYLAGFNLPKGTMILTNLTALHRDPKEWATPDT
FNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLS
LQFRMSVTISPVSHRLCAIPRL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcacagcgggttccctactaggggccatttggaccgtgctccatctccggatt
ttgctgctggctgctgtcacctttctgttcctggctgatttcctcaaacaccggcgcccc
aagaactacccgccagggccttggcgcctgcccttagtgggttgcttgttccatttggat
cctaaacagccacacctatcccttcagcagtttgtgaagaaatatgggaatgttttaagc
ctggattttgctaacattccttcagtggttgtaactggcatgcccttaatcaaagaaatc
tttactcaaatggagcacaattttttgaatcgccctgtcactcttctccgaaaacatctc
tttaacaaaaatggattgatcttctccagtggccagacatggaaggagcaaaggaggttt
gccctgatgactctgaggaactttggactaggaaagaagagcttagagcagcgaatacaa
gaggaagcctaccaccttgtggaggccataaaagatgagggaggactgccttttgaccct
cacttcaatatcaacaaagcagtctctaatatcatttgctctgtcacctttggggagcgc
tttgagtaccatgacagtcagtttcaggagatgctgaggctactggatgaggccatgtgt
ttggagtcatcaatgatgtgccagctctacaatatctttccaaggatacttcagtatctt
cctggatcacaccaaacacttttcagcaactggagaaaactgaagttgtttatttctgat
attattaagaatcaccggagagactgggatccagatgagccaagggacttcattgatgct
ttcctcaaggaaatggcaaagtacccagacaagactactacaagtttcaatgaagaaaac
ctcatctgcagtactttggatcttttctttgctggtacagagacaacatccactacactg
cgctgggctctgctctgcatggccctgtacccagaagtccaagaaaaaatgcaggctgag
attgacagagtgattggccaaggaagacagccaaacctggcagaccgagactccatgccc
tacaccaacgccgtcattcacgaggtgcagagaataggcaacatcatcccctttaatgtt
cccagggaagtggcagttgacacctatttggctggatttaacttgccaaagggtactatg
attctaaccaacttaactgcactgcacagggaccctaaagagtgggccaccccggacacc
ttcaacccagagcactttttggagaatggacagtttaagaagagagaatcctttctgcct
ttctcaatgggaaagcgagcatgtcttggagaacaactggccaggtccgagctgttcatt
tttatcacttctcttatccaaaaatttaccttcaagcccccggtcaacgagaagcttagt
ctgcaattcagaatgtccgtcaccatttccccagtcagtcaccgcctttgcgcaattcct
aggctgtga

DBGET integrated database retrieval system