KEGG   Rattus norvegicus (rat): 313387
Entry
313387            CDS       T01003                                 

Gene name
Usp1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 1
  KO
K11832  ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    313387 (Usp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    313387 (Usp1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    313387 (Usp1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    313387 (Usp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     313387 (Usp1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   313387 (Usp1)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    313387 (Usp1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     313387 (Usp1)
SSDB
Motif
Pfam: UCH UCH_1
Other DBs
NCBI-GeneID: 313387
NCBI-ProteinID: NP_001015015
RGD: 1306461
Ensembl: ENSRNOG00000007890
UniProt: Q569C3
Position
5
AA seq 784 aa
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQEDEEKASEYRGSEIDQV
VPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKAGVKHLFNIISRKK
EALKDDSIQKDKGSCKEDPLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEIKNLTEFSSKVEEKSLQK
EETGGISSTETDSTRNLDDLKEQLPKGNWKRKSDGESGNMKKKVKLSRESQPLEENQRQT
RSKRKATGDTLEASPKIIPKCVSENESAKPSQKKSKVKINWLKPATKQPSILSKFCSLGK
ITTNQRSKGQPKVNEGDLEEDLEKDGRDNTVNGSGPASPGSSVTPVDSSEAKSINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGTAENYDDEVSIRVGGNAQPSKVLNKK
NVEGIGLLGGQKSKADYELCSKASNPEKVVGTPFTDSRNSETNDTNGTQESDRSKESSDQ
TGINVSGLENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcctggcgtcatacctagtgaaagtaatgggctttcaagaggcagtccatccaagaag
aacaggctgtctttgaagttttttcagaaaaaggaaactaaaagagccttagacttcact
gattctcaagaagatgaagaaaaagcttctgaatatagaggatctgagattgatcaagtt
gttcctgctgcacagtcctcaccagtaagctgtgagaagagagaaaacttgttaccgttt
gtgggactgaataaccttggcaacacttgttatctgaatagtattcttcaggtgttgtac
ttttgtcctggcttcaaggctggagtgaagcacttatttaatattatttcaaggaagaaa
gaagctctgaaggatgactctattcagaaggataagggaagctgcaaagaagatcctttg
gcaagttatgagcttatatgcagtttacagtccttaataatctcagttgaacagcttcaa
gctagttttctcttaaatccagaaaaatatacagatgaacttgcgacacagccaaggcga
ctgcttaacaccctgagggaactcaaccctatgtatgaaggctatctccagcacgatgca
caggaagtgctacagtgtattctgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaaataaaaaacttgactgaattttccagcaaggttgaagaaaaatctcttcagaaa
gaggagacaggtgggattagcagcacagagactgacagtacgaggaatctggacgacctc
aaagaacaactcccaaaagggaactggaaaagaaagagtgacggagaatcggggaacatg
aagaaaaaggttaaactgtccagggaatcccagccattggaagaaaaccagagacaaacc
agatcgaaaagaaaagctaccggagacacactagaggcttctcctaaaatcatccccaag
tgtgtttctgaaaatgagagtgcaaagccctcacagaagaaatccaaagttaaaataaat
tggttaaagccggccactaagcagcccagcattctttccaagttctgtagtcttgggaaa
ataacaaccaaccagcgctccaaagggcaacctaaagtaaacgagggtgaccttgaggag
gatttggagaaggatggacgcgacaacacagttaatggtagtggacccgcatctccagga
agtagcgtcacacctgtggacagtagtgaagctaagtccataaacaaaggtgcagagcag
attggttttgaactagtagagaaattgtttcaaggtcagctagtactgaggactcgttgt
ttggaatgtgaaagcttaacagaaagaagagaagactttcaggatattagtgtcccggta
caagaagatgaactttctaaagtcgaggagagctctgagatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagagaattgtagga
gaggataaatatttctgtgaaaattgccatcattatacggaagcagagcgaagtctcttg
tttgataaaatgcctgaagttatcactattcatctgaagtgctttgctgctagtggcttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttattgacacctctt
aaactgtcactagaagaatggagcacaaagccgactaatgacagctatggattatttgct
gttgtgatgcacagtggcattactattagtagtgggcactatactgcatctgttaaagtc
actgaccttaacagtctagaactagataagggcaattttgtggttgaccagatgtgtgag
ataggtaagccagagccactgaatgaggaggaagcaagggggacggctgaaaattatgac
gacgaagtatcaattagagttggtggtaatgcccagccaagtaaagttttgaacaaaaaa
aatgtagaaggtattggacttcttggaggacagaagagcaaagcagattatgagctgtgc
agcaaagcatctaatcctgagaaagttgtcgggacaccattcactgacagtagaaattct
gaaactaatgatactaacgggacccaggaatctgacaggagcaaggagtccagtgaccaa
acaggcattaacgtgagtggactggagaacaaaatttcctatgtagtgcaaagcttaaag
gagtacgaggggaagtggttgctctttgatgactctgaagtaaaagttacagaagagaaa
gactttctgaattctctttccccttctacatctcctacatctactccctacttgctattt
tataaaaaactatag

DBGET integrated database retrieval system