KEGG   Rattus norvegicus (rat): 313449
Entry
313449            CDS       T01003                                 

Gene name
Upf3b
Definition
(RefSeq) regulator of nonsense transcripts 3B
  KO
K14328  regulator of nonsense transcripts 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    313449 (Upf3b)
   03015 mRNA surveillance pathway
    313449 (Upf3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    313449 (Upf3b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     313449 (Upf3b)
   mRNA cycle factors
    P-body specific factors
     313449 (Upf3b)
SSDB
Motif
Pfam: Smg4_UPF3 RRM_1
Other DBs
NCBI-GeneID: 313449
NCBI-ProteinID: NP_001129345
RGD: 1560264
Ensembl: ENSRNOG00000039994
Vega: OTTRNOG00000002019
UniProt: D3ZBE8
Position
X
AA seq 472 aa
MKEEKDHRPKEKRVTLLTPQGATGGCIGATAEGAKGDDRQDRNRDKKEALSKVVIRRLPP
TLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDILLFRDRFDGYVFL
DNKGQEYHAIVEFAPFQKAAKKKIKKRDTKVGTIEDDPEYRKFLESYATDNEKMTSTPET
LLEEIEAKNRELIAKRTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEE
KRKRKDIEKLKKIERIPEREKIRDEPKIKLLRKPEKGDEKELDKRDKTKRLDKENLNEDR
ASGHSYTLPRRSDVELKDEKPKRPDDESVRDYRDRDRDYERDQERMIRERERMKRQEEER
RRQQQKERYEKEKAFKRKEEEMKREKEALRDKGKKSENTESICSLEKIEKKEEVVKRDRI
RNKDRPAMQLYQPGARSRSRLCPADDSIKPGDSPVEKKQESGISHRKEGGEE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaaggaagaaaaagatcataggcctaaggagaaacgagtgaccctgttaacgcctcag
ggcgctacaggcggctgcattggagctaccgcagaaggcgccaaaggggacgataggcaa
gatcgcaacagggacaagaaagaagctttgagcaaggtcgtaattcgaagattacctccc
actctgaccaaggagcagcttcaggaacatcttcaacctatgcctgagcatgattatttt
gagtttttttccaatgatactagtctttatcctcatatgtatgccagagcatatatcaac
tttaaaaaccaagaggacattcttttattcagggaccgatttgatggctatgtattcctt
gacaataaaggtcaggaatatcatgctatagtagaatttgcaccatttcaaaaagctgca
aaaaagaagattaagaaaagagatacaaaagttgggactatcgaggatgatccagaatac
agaaaatttttggagagttatgccacagacaatgagaaaatgacatctactccagagaca
ttgctggaagaaattgaagccaaaaatcgagaattaatagctaaaaggacaaccccactt
ttgagcttcctgaagaacaagcagagaatgagagaagaaaagagagaagagaggaggaga
cgggaaatagagaggaaaagacaaagagaagaagagagaagaaaatggaaagaagaggag
aaacgaaaaagaaaagatatagaaaaactaaagaagatagaaagaattccagaaagggaa
aagataagggatgaaccaaagattaagctgctcaggaaaccagaaaaaggagatgaaaag
gaacttgataaaagagacaaaaccaagagactggacaaagaaaatctgaatgaagacaga
gccagtgggcacagttatactctgcccaggcgttctgatgtcgaactgaaggatgaaaaa
ccaaagaggcctgatgacgagagtgtcagagactacagagatagggaccgggattatgaa
agagatcaggagcgcatgatccgagaaagagagaggatgaagcggcaggaagaagagcgc
cggaggcagcagcagaaggagcgctatgagaaagagaaggcttttaagcgaaaggaagaa
gaaatgaagagagagaaagaagcacttcgagataaaggaaagaagagtgagaatacagaa
tcaatatgctcgttagaaaaaattgaaaaaaaagaggaagtggttaagagagatcgcata
aggaacaaggatcgtccagcaatgcagctttaccaaccaggggctcgaagccgaagtcga
ctctgtcccgccgatgacagcatcaagcctggagattccccagtggagaaaaagcaggaa
agtggtattagccatagaaaagaaggaggagaggagtga

KEGG   Rattus norvegicus (rat): 361176
Entry
361176            CDS       T01003                                 

Gene name
Upf3a
Definition
(RefSeq) regulator of nonsense transcripts 3A
  KO
K14328  regulator of nonsense transcripts 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    361176 (Upf3a)
   03015 mRNA surveillance pathway
    361176 (Upf3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361176 (Upf3a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     361176 (Upf3a)
   mRNA cycle factors
    P-body specific factors
     361176 (Upf3a)
SSDB
Motif
Pfam: Smg4_UPF3
Other DBs
NCBI-GeneID: 361176
NCBI-ProteinID: NP_001012159
RGD: 1308778
Ensembl: ENSRNOG00000017397
Vega: OTTRNOG00000001994
UniProt: Q5I0C8
Position
16
AA seq 405 aa
MRSEEGAGGLGAVLSARGPSWREKLSGAETHFRRESTRNESAAPPAPALSESGVGKPREE
KRTALSKVVLRRLPPGLTKEQLEEQLRPLPAHDYFEVVAADLSLYPHLYSRAYINFRNPD
DILLFRDRFDGYIFIGNKGLEYPAVVEFAPFQKIAKKKVKKKDAKTGSIEDDPEYKQFLE
SYSLEEEKTSASPETLLGEIEAKTRELLARRTTPLLEYIKNRKLEKQRLREEKREERRRR
ELEKKRLREEEKRKRREEDRCKRKDAEKQKRAEKDVRIKLLKKLETGEEATTEKHKERGE
AVGAGEEKQEARLVESQPETPGERLQDGSDKEPRDKRFREKEPETPRCHDSCRKHSTHSE
FARFSRRSEEEPKWRKGFTQDGGERGQDGGVPADGRAKQQGAQGV
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcgctcggaagagggggccggaggcctgggcgcagtcctttctgcgcggggcccgagc
tggagggagaaactgtccggagcagagacccatttccgccgcgagtctacgcggaatgag
tcggcggcgcccccggccccggccttaagtgagagcggggtcggcaagcctcgcgaggag
aagaggacggccctgagcaaggttgtcctccggcgtctgcccccgggcctcaccaaagag
cagctggaagagcaactgcgtcctctacccgcgcacgattacttcgaggtggtggctgcg
gacctcagcctctaccctcacctctactccagagcgtacattaattttaggaaccctgat
gacatcctgctgttcagagaccgttttgatggatacatcttcattggcaataaaggcctg
gagtaccctgcagtggtggagtttgctccattccagaagattgccaaaaagaaggtgaag
aaaaaggatgccaagaccggaagcatcgaagacgacccagagtataaacagttcctggag
tcgtacagcttggaggaagaaaagaccagcgctagtcctgagacactgctgggagagata
gaggcgaagacgagagagttgctggccagaagaaccacacctcttttggaatatattaaa
aacagaaaattagaaaagcagagactccgggaagaaaaacgcgaggagcggaggaggagg
gagctggagaagaagcgtctgcgggaggaagagaagaggaagcggagagaagaggacagg
tgtaaaaggaaagatgcagaaaaacagaagcgagcggagaaggacgtgaggatcaagctt
cttaagaaactggaaacgggagaagaagcgaccactgagaaacacaaagaaagaggtgaa
gccgttggtgctggcgaggagaagcaggaagcccggctggtggagagccagccggagaca
cctggggagaggttacaggacggcagtgataaagaaccaagggacaaaagatttcgagag
aaagagcctgagactccgagatgccatgacagttgcagaaagcacagcactcactcagag
tttgccaggttttccagaaggagcgaggaggagccaaagtggaggaaaggcttcacccag
gacggaggggagaggggccaggacgggggcgtccctgcggatggcagagcaaagcagcaa
ggagcacaaggagtatga

DBGET integrated database retrieval system