KEGG   Rattus norvegicus (rat): 313474
Entry
313474            CDS       T01003                                 

Gene name
Eps15, RGD1307641
Definition
(RefSeq) epidermal growth factor receptor pathway substrate 15
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    313474 (Eps15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    313474 (Eps15)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    313474 (Eps15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7 ATG16 Spc7 FPP IFT57 TMF_DNA_bd RasGAP_C UPF0242 TPR_MLP1_2 Crescentin Fez1 Filament DUF3584 EzrA Golgin_A5 HrpB7 TMF_TATA_bd AAA_13 DUF948
Other DBs
NCBI-GeneID: 313474
NCBI-ProteinID: NP_001009424
RGD: 1305550
Ensembl: ENSRNOG00000010299
UniProt: Q5JC29
Position
5q34-q35
AA seq 792 aa
MAAAAQLSLTQLSSGNPVYEKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLA
DTDGKGVLNKQEFFIALRLVACAQNGLEVSLSSLNLAVPPPRFHDSSSPLLTSGTSVAEL
PWAVKSEDKAKYDAIFDSLSPVDGFLSGDKVKPVLLNSKLPVEILGRVWELSDIDHDGKL
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GYVSGLEVRETFLKTGLPSTLLAHIWALCDTKNCGKLSKDQFALAFHLINQKLIKGIDPP
HSLTPEMIPPSDRSSLQKNTIGSSPVADFSAIKELDTLNNEIIDLQREKNNVEQDLKEKE
DTVRQRTTEAQDLQDEVQRESLNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAEITSQESQISTYEEELSKAREELSRLQQETAQLEESVESGKAQLEPLQQ
HLQDSQQEISSMQMRLAMKDLETDNNQSNWCSSPQSILVNGAADYCSLSTSSSETANLNE
HAEGQNNLESEPIHPESSVRSSPEIAPSDVTDESEVVTAADIEKVSPRFDDDKHSKEEDP
FNVESSSLTDAVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFK
QTSTDPFATSSTDPFSVSSNSSNTSVETWKHNDPFAPGGTVVAATDSATDPFASVFGNES
FGDGFADFSTLSKVSNEDPFNPTISSSASSVVIPNPVLEETPSKSEDVPPALPPKTGTPT
RPCPPPPAFPRQ
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggctgcggcagcccagctctccctgacacagttgtcaagtgggaatcctgtatatgaa
aaatactatagacaggttgaagcaggcaatactggaagggtgttggctttagatgctgct
gcattcctgaaaaagtcagggcttccagacctgattcttggaaagatttgggatttagct
gacacagatggcaaaggtgtcctgaacaaacaagaattctttattgctttacggcttgtg
gcatgcgcccagaatggactggaagtgtcactgagtagcctaaatctggctgttcctcca
ccaagatttcatgactccagtagtcctttgctaaccagtgggacctcagttgctgagctc
ccatgggctgtaaagtctgaagataaagccaaatatgatgcaatttttgacagtttaagc
ccagtggatggatttttgtctggtgataaagtgaaaccagtgttgctcaactctaagtta
cctgtggaaatccttggaagagtttgggagttgagtgatattgaccacgatggaaagctg
gacagagatgagtttgcagttgccatgtttttggtatactgtgcactggagaaagaacct
gtgccaatgtccttgcctccagccttggtgccaccttctaagagaaaaacgtgggttgtg
tcccctgcagaaaaagctaaatatgatgaaatctttctgaaaactgataaggatatggat
ggatatgtgtctggactggaggtccgtgaaaccttcctaaaaacaggtttaccttctacc
ttgctagcccacatttgggcactatgtgacacaaagaattgtgggaagctttcaaaagac
cagtttgccttggcttttcacttaatcaatcagaagttaataaaaggcattgaccctcct
catagtctcactcctgagatgattccaccatcagacaggtccagtttacaaaagaacacc
ataggatcaagtcctgttgcagatttctctgctattaaggaactagatacccttaacaat
gaaataattgacctgcagagggaaaagaacaatgtggaacaggacctgaaagagaaggag
gacacagtgaggcagaggaccaccgaggctcaggatcttcaagatgaagttcaaagggag
agtcttaatctacaaaaactgcaggcccagaagcagcaggtgcaggaactcctggatgaa
ctggatgagcagaaagcccagctggaagagcagctcaaagaagtcagaaaaaaatgtgct
gaggaggcccagctgatttcttccctgaaagcagaaataaccagtcaagaatctcagatc
tccacttatgaggaagaattgtcgaaagctagagaagaactaagtcgcctacaacaagaa
acggcacaattggaagaaagtgtggagtcaggaaaggctcagctagaacctcttcagcag
cacctacaagattcgcaacaggaaatcagttcaatgcaaatgagattggcaatgaaagat
ctggaaacggacaataaccaatcaaattggtgcagtagcccacaaagcattctggtcaat
ggtgctgcagattattgtagcctcagcaccagcagcagtgaaacagccaacctcaatgaa
catgctgaaggccagaataacctagagtctgagcccatccatccggagtcatcagtgaga
agtagtcctgaaatagcgccttctgatgtgactgatgaaagcgaagttgtgactgcagct
gatattgaaaaagttagtcccagatttgatgatgacaagcactcaaaagaggaagatcca
tttaatgtagaatccagttcactgacagatgcagttgcagatacaaacttggattttttc
cagtctgacccttttgttggcagtgatcctttcaaggatgatccttttggaaaaattgat
ccatttggtggtgatcctttcaaaggttcagacccatttgcatctgattgcttctttaaa
cagacttctactgatccttttgccacttcaagtactgaccctttcagtgtatccagcaat
agcagtaatacatcggtagagacttggaagcacaatgacccatttgctcctggtgggaca
gttgttgcagctactgactcagccacagacccttttgcttctgtttttggaaatgaatca
tttggagatggatttgctgacttcagcacattatctaaggtcagcaatgaagatcctttt
aatcctaccatatcaagttctgccagcagtgtggtcattccaaaccctgtgttagaggaa
acacccagcaagagtgaagatgtgcctccagcactgccacccaagaccggcactccaaca
agaccctgcccaccaccccctgcctttcccaggcaatga

DBGET integrated database retrieval system