KEGG   Rattus norvegicus (rat): 313479Help
Entry
313479            CDS       T01003                                 

Gene name
Orc1, Orc1l
Definition
(RefSeq) origin recognition complex, subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313479 (Orc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    313479 (Orc1)
   03036 Chromosome and associated proteins [BR:rno03036]
    313479 (Orc1)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    313479 (Orc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     313479 (Orc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cdc6_C BAH AAA AAA_22 AAA_16 AAA_lid_10 AAA_30 AAA_19 NACHT DUF2075 NB-ARC SpoU_methylas_C
Motif
Other DBs
NCBI-GeneID: 313479
NCBI-ProteinID: NP_808792
RGD: 631435
Ensembl: ENSRNOG00000008841
UniProt: Q80Z32
Position
5q34
AA seq 848 aa AA seqDB search
MPSYVTRQKTRQTFSWVGRPLPNRKQFYQMYKEICMKINGCSEIHIKVGQFVLIQGEDNQ
KPYVAKLIELFENGSEVPPKKYARVQWFVRFCEIPIPKRHLLGRRPSAQEIFWYDCSDCD
NDIHVETIIGPVQVVALAPEDEIPVNQKSEETLFVKLSWNKKNFAPLPPEELAALRRLEC
QKPLEAKTKSVKSPSWSTAEQEVKRIESSHSTSRSYQDPAHTVTPNAMKSLECGGFTRKP
NMRLSRKILCDSLDSQKTCKRRAAFSETTSPPKKPQPGEIKTSSALETLGKNGHTQPFFA
KSSMVLRTRGTAVKTTKLTVESALSPVRSRSRYSVAPSVGLTPQYIGRKAKEQETHKEPI
HTSLRARRRSSLLTLKRIKQQLWLLDDDKSDQEEEESISSVEVSDSSSEEEDESVPSPPT
GKPVGQSRTRRTASKPSSQTPSKSPKKTFRPRPPLHATPQIRDRNLAVQEPASVLEEARL
RLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQ
AAQTNDVPPFEYVEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCSRGSQKE
TTVLLVDELDLLWTHKQDVLYNLFDWPTHKGARLVVLTIANTMDLPERIMMNRVASRLGL
TRMSFQPYSHSQLKQILVSRLKHLKAFEDDAVQLVARKVAALSGDARRCLDICRRATEIC
EVSHQRGDSQCLVTVAHLMEAIDEMFSSSYITAIKNSSVLEQSFLRAIIAEFRRSGLEEA
TFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRILLVEPSRNDLLLRVRLNVSQND
VLYALKEE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcctatgtcacaaggcagaagaccagacaaactttctcatgggttggcaggcca
ttgccgaatcgaaaacagttctaccaaatgtacaaagaaatttgtatgaaaatcaatggt
tgttctgagattcacatcaaggttggacagtttgtattgattcaaggggaagataatcaa
aagccctatgttgctaaactgattgaattatttgaaaatgggtctgaagttcctcccaag
aaatatgcgcgagtacaatggtttgtccgattctgtgagattcctatccctaaaaggcat
ttgttaggacggagaccttctgcacaggagatattctggtatgactgttctgactgtgat
aacgacattcatgtggagaccatcattggccctgttcaggtagtggcattagccccagaa
gacgagatccctgtgaatcagaaaagtgaggagacactgtttgtgaagctgtcctggaat
aaaaagaactttgcgccactgccaccagaagaacttgcagcattgaggagactggagtgc
caaaaacctttagaagccaagactaagagtgttaaaagcccttcctggagcacagcagaa
caagaggtcaaaaggattgaatcaagtcattccacttccagatcttaccaggatcctgct
catactgtcactcccaacgcaatgaagtctctggaatgtggtggttttaccaggaagcct
aacatgaggctgtcacggaagatcttgtgtgattccttggattctcaaaaaacatgtaaa
cgaagagcagccttctctgagaccacctcaccacctaaaaagcctcaacctggtgaaatc
aagacctcctcagctttggaaactctaggaaaaaatgggcatactcaacccttttttgcc
aaaagtagcatggttctgagaacccggggcacagctgtgaagaccacaaagcttactgtg
gagagtgcacttagccctgtcaggagcaggtcgaggtactcagtggcaccctctgtgggt
ctgacacctcaatacattgggaggaaggcaaaagaacaagaaactcacaaagaacccatc
catacttctcttcgtgcccgtagaaggagttctctcttgactttgaagcggattaagcaa
cagctttggcttctagatgatgataaaagtgaccaagaagaggaagagtccatatcctct
gtggaagtgtcagactccagtagtgaggaggaagatgagtctgttccctcccctccaaca
ggaaaacccgtggggcagtccaggacccggagaactgcctctaagccatcatcacagacc
ccctccaagtcaccaaagaaaacttttagacctagaccacctcttcatgctactcctcag
atccgagacagaaacttggctgtccaagagccagctagtgtgcttgaagaggcccggctc
aggctgcatgtttctgccgtgcctgactctcttccctgtcgagagcaggagttccaagac
atctacagctttgtggaaagtaaacttcttgatggaaccggagggtgtatgtacatttct
ggggtccctgggacagggaagacagccactgtgcatgaagtcatacgctgtctgcagcag
gcagcacaaacaaatgatgttcctccctttgaatacgttgaggttaatgggatgaagctg
acagaaccccaccaggtctatgtgcagattttacagaaactgacaggccagaaggcaaca
gctaatcatgcagcagaactgctggcaaagcaattctgcagccgagggtcccagaaggaa
accactgtgctgcttgtggatgagcttgaccttctttggactcacaaacaagatgtgttg
tacaacctctttgattggcctactcacaaaggagcccggttggtcgtgttgactattgcc
aataccatggaccttccagagaggatcatgatgaaccgtgtggctagccgcctgggcctc
accaggatgtctttccaaccctactctcacagccaactgaaacaaatcttagtgtcccga
ctgaagcatttaaaggcctttgaggatgatgccgtccagttggtagccagaaaggtagca
gccctttctggagatgcccggcgctgcctggacatctgcaggcgtgccacagagatctgc
gaggtttcccatcagcgtggtgactctcagtgcctggtgactgtggcccacttaatggaa
gctatagatgaaatgttttcctcatcctatattactgccatcaaaaactcttctgtcctg
gaacagagcttcctgagagccatcattgcggaattccgtcgatcaggactggaggaagct
acatttcaacagatatacagtcagcatgtggctctgtgcagaatggagggactgccttac
ccaaccatgtcagagaccatggccgtgtgctcgcgtctgggttcttgccgcattcttctg
gtggagcctagcaggaatgacctactccttcgagtgagactcaatgttagccagaatgat
gtgctgtatgctctcaaagaagagtga

DBGET integrated database retrieval system