KEGG   Rattus norvegicus (rat): 313488
Entry
313488            CDS       T01003                                 

Gene name
Reck
Definition
(RefSeq) reversion-inducing-cysteine-rich protein with kazal motifs
  KO
K17461  reversion-inducing-cysteine-rich protein with kazal motifs
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    313488 (Reck)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 Pacifastin_I DB DNA_pol_E_B
Other DBs
NCBI-GeneID: 313488
NCBI-ProteinID: NP_001101424
RGD: 1308845
Ensembl: ENSRNOG00000014863
UniProt: D4ABJ4
Position
5q22
AA seq 920 aa
MASVRASARGALLLLLSAAGVAKVTGGLAPGSAGAVCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREFCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEEHACQSACRRILTSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTSV
CRELCTKLYSMSWGNTQSWQEFDRICEYNPGEVSMLACLADVREPCQLGCTNLTYCTNFN
NRPTELFRSCTAQSDQGAMSDMRLWEKGSIKMPFISIPVLDIRTCQPDLWKAVACSLQIK
PCHRKSRGSIICKSDCVEILKKCGDQNKFPEAHTAESICEFLSPADDVENCIPLDTYLRP
SALGNIIEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYSCVQGCKLGEASDFIVRQG
ALIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFTIDCNV
CSCFAGNLVCSTRLCLSEHSSDDDRRAFTGLPCNCADQFVPVCAQNGRTYPSACIARCVG
LQDHQFEFGPCISKDPCNPNLCPKSQRCVPKPQVCLTTFDKFGCSQYECVPRQLTCDQAR
DPVCDTDHVEHSNLCTLYQRGKSLSYRGPCQPFCRTTEPVCGHNGETYSSVCAAYSDRVA
VDYYGRCQAVGVLSEHSAVTECAAVKCPSLSAIGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKIEACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSLPSSAVVGRLPPV
HSLPLFLSLGLTVHLLQTCP
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggcgagcgtccgggcctccgcgagaggcgcgctgctgcttctgctgtccgcggcgggg
gtcgcgaaggtgaccgggggcctggccccgggcagcgcgggtgctgtgtgctgtaatcat
tcaaaggataaccaaatgtgccgtgatgtgtgtgagcagattttctcctcaaaaagtgaa
tcccgactgaaacatctgttgcagagagccccagattattgcccagagacaatggttgaa
atttggagttgcatgaactcatctttgccaggtgtatttaagaagtcggatggctgggtt
ggcttaggctgctgtgagctagccattggcttggagtgccgccaggcatgcaagcaggca
tcttcaaagaatgatatttccaaagtttgcaggaaagaatatgagaacgctcttttcagt
tgcattagcagaaatgaaatgggctcggtgtgctgcagttacgcggggcatcacaccaac
tgccgagaattctgtcaagccatttttcgaacagactcctctcctggaccatctcagatc
aaagcagtggaaaattattgtgcgtctattagtccacagttgatacactgtgtgaacaat
tacacccagtcgtatccaatgagaaacccaactgacagtttgtactgctgtgacagagct
gaagagcatgcttgccagagcgcctgcaggaggattctaacgtctaagaagacagaaatg
gagattgtggacggcctcattgagggttgcaagacccagcccttgcctcaagatcctctt
tggcagtgttttctcgaaagctcacagtcagttcaccctggagtcaccgtgcaccctcct
ccctcaaccggccttgatggggccaaattgcattgttgctctaaagcaaacacctcagtg
tgtagggaattgtgcacgaaactctacagcatgagctggggaaacacacagagctggcag
gagtttgaccgcatctgtgaatataaccccggggaagtgtccatgctggcctgtctggct
gatgtccgggagccttgccagttgggttgtacaaaccttacttactgtacaaactttaac
aacaggccaacagaacttttcaggagctgcacggcgcagtctgaccagggcgccatgagt
gacatgaggctgtgggagaagggcagcataaagatgcccttcatcagcatccccgtcctg
gacattagaacctgccagccagacctgtggaaggccgtcgcctgctccctgcagatcaag
ccgtgccacaggaagtcccgagggagcatcatctgcaaatcagattgtgtagagattctc
aagaaatgtggagaccagaataaattccctgaagcccacacagctgaaagtatctgtgag
ttcctgtcccctgcagatgatgtggagaactgtatacctctggacacatacctcaggcca
agtgctttaggcaacatcatagaggaagtgactcatccctgtaatccaaatccttgccca
gccaatgagctctgtgaagtaaaccgaaaggggtgtccgtctggagatccctgccttccg
tactcctgtgttcaaggctgcaaattgggagaagcgtctgacttcattgtccgccaaggg
gcactgatccaggtgccatcctctgcaggggaagttggttgttacaaaatctgttcctgt
ggacaaagtggcctcttggaaaactgcatggaaatgcactgtattgacctccagaagtct
tgcattgttggagggaaaagaaagagtcatggaacatcctttaccatcgactgcaacgtc
tgttcttgttttgccggcaatttagtgtgttccacccgtctgtgcctcagtgagcacagt
tcagacgatgaccgccgcgccttcacaggtctgccctgtaactgcgcagatcagtttgtc
ccagtgtgtgcacagaatggacgcacttaccccagtgcctgcatcgctcgctgtgtgggt
ctccaggaccatcagtttgagtttggaccttgtatctccaaggatccctgtaatcctaac
ctctgccccaaaagccaaagatgtgtgcccaaaccgcaagtctgcctgactacttttgat
aaatttggatgtagccagtatgagtgcgtgcccagacagctcacgtgtgaccaggcccga
gatcctgtgtgtgacacagatcatgtggagcacagcaacctctgcactttgtaccaaaga
ggaaaaagcctgtcctacagaggcccgtgccagcctttctgcagaaccacggagcctgtt
tgtgggcacaatggtgagacgtacagcagtgtgtgcgctgcctactcggatcgtgtggca
gtggattactatgggcgctgccaggctgtcggggtcctctcggaacacagtgctgtgacc
gagtgtgctgctgtgaagtgtccttccctctcagctataggttgcaaacccatcattcca
ccaggggcttgctgcccattatgtgctgggatgctacgggttttatttgacaaagaaaag
ttggacacaattgctaagattgaggcctgcaataaggaagcagagaaaatcgagtccctc
atcaactccgacagccccacgctggcatcccacgtcccgctgtccgccctcatcatctcc
caggtgcaggtgtccagcagtctcccgtcatccgctgttgtgggcaggcttcctcccgtc
cactcgttgcccctcttcctcagcctgggcctcactgtgcacctgctccagacctgtccc
tga

DBGET integrated database retrieval system