KEGG   Rattus norvegicus (rat): 313494
Entry
313494            CDS       T01003                                 

Gene name
Tln1
Definition
(RefSeq) talin-1
  KO
K06271  talin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    313494 (Tln1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    313494 (Tln1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    313494 (Tln1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    313494 (Tln1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    313494 (Tln1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   313494 (Tln1)
  Exosomal proteins of other cancer cells
   313494 (Tln1)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N ACBP IRS DUF1013 GIT1_C ADH_zinc_N_2 DUF3025 RA
Other DBs
NCBI-GeneID: 313494
NCBI-ProteinID: NP_001034114
RGD: 1306247
Ensembl: ENSRNOG00000016630
UniProt: G3V852
Position
5
AA seq 2541 aa
MVALSLRISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKAEHGSVALPAIMRSGASGPENFQVGSMPPAQQQVTSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQAALDDFDALPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDILMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAAREGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTTDPAVQAIVLDTASDALDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRV
QELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAFHPEVAPDVRLRALHFGRECANGYLELLDHVLLTLQKPNPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt   +upstreamnt  +downstreamnt
atggttgcgctttcgctgaggatcagcattgggaacgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgatgcctgccgcatgattcgtgagcggatcccagaggccctg
gctggccctcccagcgactttgggctatttctgtcagatgatgaccccaaaaaaggtatc
tggctcgaggctgggaaagctctggactactacatgctccgaaatggggacaccatggag
tacagaaaaaaacagagacccctgaagatccggatgttagatggaactgtgaagactatc
atggtggatgactccaagactgtcacagacatgctcatgactatctgtgcccgaattggt
atcaccaaccatgacgaatattcactggttcgagagctgatggaagaaaagaaggatgag
gggacagggaccctaagaaaagacaagaccctgttgcgagatgaaaagaagatggagaaa
ctaaagcagaagttgcacacagacgatgagttgaactggctggaccatgggcggacactg
agggaacagggagtggaagagcatgagacgttgctgctgcggagaaagttcttctactca
gaccagaatgtggactcccgcgaccctgtacagctgaaccttctttatgtgcaggcacga
gatgacatcctgaacggctcccaccctgtctcctttgacaaggcctgtgagtttgcaggc
ttccaatgccagatccagtttggacctcacaatgaacagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttt
caggcgcacaaaaattgtgggcagatgagtgaaattgaggccaaggtacgctatgtgaag
ctggcccgttccctcaagacttacggtgtctccttcttcctagtgaaggaaaagatgaag
gggaagaataaactagtgcccaggctgttgggcatcaccaaggaatgtgtgatgcgtgtg
gatgagaagaccaaggaggtgatccaggaatggagcctcaccaacatcaaacgctgggct
gcctctcccaagagcttcactttggactttggagactaccaggatggctactactcagta
cagacgactgaaggggagcagattgcacagctcattgctggctacatcgacatcatcctt
aagaagaaaaaaagcaaggaccattttgggctggagggagatgaagagtctactatgttg
gaggactcagtttctcccaaaaagtcaacagtccttcagcagcaatacaaccgagtgggg
aaagcagagcatggctctgtggccctaccagccatcatgcgctctggagcctctggccct
gagaatttccaagtggggagcatgccgcctgcccagcagcaggttaccagtggccagatg
caccgcggacacatgccacctttgacttcagcccagcaggcgctcactggaaccattaac
tccagcatgcaggctgtgcaggccgcccaagctgctcttgatgactttgatgctctgccc
cctctgggccaggatgctgcctccaaagcttggcgtaagaacaagatggatgaatcaaag
catgagatccactcccaggtagatgccatcacagctggcactgcctccgtggtaaacctg
acagcaggagaccctgcagagacagactataccgcagtgggctgtgcagtcaccaccatc
tcttccaacctgacggagatgtcccgtggagtgaagttgttggctgccctgctggaggat
gaaggtggcaatggccggccccttctgcaagcagcaaagggccttgcaggggcagtgtca
gaactgcttcgcagcgctcagcccgccagtgctgagccccgtcagaacctgctgcaggcg
gctgggaacgtgggccaggccagtggggagctgttgcagcaaattggggagagtgacact
gacccccacttccaggatattctgatgcagctagcaaaggcagtggctagtgctgcagcc
gccctggtcctcaaggccaagagtgtggcccagcgcacagaggattcagggcttcagacc
caagttattgctgcagctacacagtgtgccctgtccacttcccaactagtggcctgcacc
aaggtggtagctcctacgatcagctcacctgtctgccaggaacagctggtagaggcggga
cgactggtggccaaggctgtggagggctgtgtgtctgcctcccaagcagctacagaagac
ggacaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctcaatgag
ctgctgcagcatgtgaaggcccatgccacaggggctgggcctgctggtcgatacgaccaa
gccactgataccatcctcactgtcactgaaaatatcttcagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacctcagacctggtcaatgctatc
aaggccgatgctgagggggagagtgatctggagaactctaggaagctcctgagtgctgcc
aagatccttgctgatgccaccgccaagatggtggaggcggccaagggagcagccgcccac
cccgacagtgaggagcagcagcagcgactacgtgaagcggctgaggggctccgcatggcc
accaatgcagctgcacagaatgccatcaagaagaagttggtgcagcgtctggagcatgca
gccaaacaagctgcagcctctgctacacagaccatcgctgcagcacagcatgcagcctct
gcccccaaggcctctgcaggcccccagccactactggtacagagctgtaaggctgtggca
gagcagattccattgctggtgcagggtgtccgaggaagccaagctcaacctgacagccct
agtgctcagctcgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagcagcaaaggcctcagtgccaacaattcaggaccaggcttcagcgatgcagctg
agtcagtgtgcaaagaacctaggcactgccctggccgagctccgcactgctgcccagaag
gctcaggaggcatgtggacctttggagatggactccgcactgagcgtcgtacagaatcta
gagaaggacctgcaggagataaaagcagccgctcgcgagggcaaacttaaaccgttaccc
ggggagacgatggagaagtgtacccaagatcttggcaacagcaccaaagcggtgagctct
gccatcgccaagctgctgggggagattgcccagggcaacgagaactatgcaggtattgca
gctcgggatgtagcaggtggactaaggtcacttgcccaggctgcacggggtgtagctgca
ctgacaacagatcctgcagtgcaggccattgtgcttgacacagccagtgacgctctggac
aaggccagcagcctcattgaggaggcaaagaaagcatccggccatccaggggacccggag
agccagcaaaggcttgcccaggtggctaaagcagtgacgcaggccctgaaccgctgtgtc
agctgcctgcctggccagagagatgtggataacgccctaagagctgttggagatgccagc
aagcgactcctgagtgactcgcttcctccaagcaccgggacgtttcaggaagcacagagc
cgactgaatgaagctgctgctgggttaaatcaggcggccacagagctggtgcaggcctcc
cgaggaaccccacaggacctggctcgggcctcaggtcgattcggacaggacttcagcacc
ttcctggaagctggtgtggagatggctggacaggccccgagccaggaggaccgagcccag
gtggtgtccaacttgaagggcatatccatgtcttcgagcaaacttcttctggctgctaag
gccttgtccacagaccctgctgctcccaacctcaagagtcagctggctgcagctgcccgg
gcagtgacagacagcatcaaccagctcatcaccatgtgcacccagcaagcccctggccag
aaggagtgtgacaacgcacttcggcagctagagacggtccgagagctcctggagaaccca
gtgcagcccatcaacgacatgtcctacttcggttgcttggacagtgtcatggagaactct
aaggtcctaggtgaagccatgactggcatctcccagaatgccaagaatggaaatctgcca
gagtttggagatgccattgccacagcctccaaggctctctgcggcttcactgaggcagcc
gcacaggcagcatatctggttggtgtctctgaccccaatagccaagctggacagcaagga
ctggtggaacccacacagtttgcccgcgcaaaccaggcaattcagatggcctgtcagagt
ctgggggagcctggctgtacccaggcccaggtgttgtctgcagccactattgtggccaag
cacacttctgccctgtgtaacagctgtcgcctggcttccgctcggactgccaatcccact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagtacagccaatcttgtc
aagaccatcaaggcactagatggggccttcacagaagagaaccgggcccagtgccgagcg
gccacagcccctctgctggaagctgtggataacctgagtgcctttgcatccaaccctgag
ttctctagcgttcctgcccagatcagccctgagggccgagctgccatggagcccattgta
atctctgctaagacaatgttagagagtgctggagggctcatccagacagctcgggcatta
gcagtcaatccacgggatcctccacgttggtcggtgctagctggccactctcggactgtc
tcagattccatcaagaaacttattacaagcatgagagacaaagccccgggacagttggag
tgtgagacagccattgcagctctgaacagctgcttgcgggacctggaccaggcttctctt
gctgctgtcagccaacagctggctccccgtgaaggaatctcccaagaggctctgcacacc
cagatgctcactgcagtgcaggaaatttcccatctcattgagccactggccagtgctgct
cgagctgaagcctcccagctgggacacaaggtgtcccaaatggcccagtactttgagcca
ctcaccctggccgcagtgggtgctgcatctaagaccctgagccacccacagcagatggca
cttctggaccagacgaaaacattggcagagtctgccttgcagttgctatacactgccaag
gaggccggtggtaaccctaagcaagcagcacacacccaggaagccctggaggaagctgtg
cagatgatgacagaagctgtagaagacctgacaacaaccctcaacgaagcagctagtgct
gcaggggtcgttggtggcatggtggactccatcacccaggctatcaaccagctagatgaa
ggacctatgggtgaaccagaaggttcgttcgtagattatcagacaaccatggtgaggaca
gccaaggccatagctgtcactgttcaagaaatggtaaccaagtcgaacaccagccctgaa
gagctgggccctcttgccaaccagctgaccagtgactatggccgactggcctcacaagcc
aagcctgcagctgtggctgctgagaatgaggagataggtgcgcatatcaagcaccgagta
caggagctgggccatggctgttctgctctggtcaccaaggcaggcgccttgcagtgtagc
cccagtgatgtctacaccaagaaggagctcatagagtgcgcccgcagagtatcagagaag
gtctcccatgttctggctgcactccaggctgggaatcgtggtacccaggcctgcatcaca
gcagccagtgctgtgtctggtatcattgctgaccttgacaccaccatcatgtttgctact
gctggcacacttaaccgtgagggtgccgaaacttttgcagaccaccgggagggtatctta
aagacagcaaaggttcttgtggaggacaccaaggtcctggtacaaaatgcagctgggagc
caggagaagttggcacaagctgcccagtcctcagtggccaccattacccgcctcgctgat
gtagtcaagcttggtgcagccagcctaggagctgaggaccccgaaactcaggtggtgctg
atcaatgcagtaaaggacgtagccaaggccctgggagacctcatcagtgcaacgaaggct
gcagcgggcaaagttggggatgaccctgcagtgtggcagctcaagaactctgctaaggtg
atggtgactaatgtgacatcgttgctcaagactgtgaaggctgtggaagatgaggccacc
aaaggcacccgggccctagaggcaaccacagagcacatacgtcaggaactggcggtcttc
tgttccccagagccccctgccaagacctccacccctgaagatttcatccgaatgaccaag
ggtattactatggcaacagccaaagctgttgctgctggcaattcctgtcggcaggaagat
gtcattgccacagccaatctgagccgacgtgctattgcagacatgcttcgggcttgcaag
gaagcagctttccacccagaagtggcacctgatgtgcggcttcgagccctacactttggc
cgggagtgtgccaatggctacctggagctgctggaccacgtgctgctgaccctccagaag
ccaaacccagaactaaagcagcagctgacaggacactcaaagcgagttgctggctcggtg
actgagcttatccaagctgctgaagccatgaaaggaacagagtgggtggaccccgaggac
cctactgttattgccgagaacgagcttctgggagccgcagctgccattgaggctgcggcc
aaaaagctagagcaactgaagccccgggccaagcccaaggaggcagatgagtccttgaac
tttgaggagcaaatcctggaagctgccaagtccatcgccgcagccaccagtgcactagta
aaggcggcctcagcagcccagagggagctggtggctcagggaaaggtgggcgccattcca
gccaatgcactggacgatgggcagtggtcgcagggcctcatttccgctgcccgtatggtg
gctgcggccaccaacaatctgtgtgaagcagccaatgcagctgtccagggccatgctagc
caggagaaactcatttcttcagccaagcaagtagctgcctccacagcccagctcctggtc
gcttgcaaggtcaaagcagatcaggactcagaggcaatgaagaggcttcaggctgctggc
aatgcagtgaagagggcttcagataacctggtaaaggcggcccagaaagctgcagccttc
gaagaccaggagaatgagacggtggtggtgaaggagaaaatggttgggggcattgcccag
attatcgcagcacaggaagagatgcttcggaaggaacgagagctggaagaggctcggaaa
aagcttgcccagatccggcagcagcagtacaagttcttgccttcagagcttcgagacgag
cactga

KEGG   Rattus norvegicus (rat): 315776
Entry
315776            CDS       T01003                                 

Gene name
Tln2
Definition
(RefSeq) talin-2 isoform X1
  KO
K06271  talin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    315776 (Tln2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    315776 (Tln2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    315776 (Tln2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    315776 (Tln2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315776 (Tln2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   315776 (Tln2)
  Exosomal proteins of other cancer cells
   315776 (Tln2)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP Myosin_TH1 GIT1_C
Other DBs
NCBI-GeneID: 315776
NCBI-ProteinID: XP_008764624
RGD: 1565416
Ensembl: ENSRNOG00000018373
Position
8
AA seq 2559 aa
MKMVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDP
RKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTIC
SRIGITNYEEYSLIQETIEEKKEEGTGTLRKDRTLLRDERKMEKLKAKLHTDDDLNWLDH
SRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKAC
EFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAK
VKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTT
VKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDE
ESTMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQV
MVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNK
VDESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLA
ALMDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQI
GENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQ
LVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATGDSELLKQVSAAASVVS
QALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSD
LVNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAE
GLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSC
KTVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAA
AMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKSELQDAKMAAAESQL
KPLPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAAR
GVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSL
NNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEV
VHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLL
LAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIMLCTQQAPGQKECDNALRELETVKGM
LENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGL
TEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAAT
IVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRN
KCRIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRT
ARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIE
QASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLAS
YFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAIT
EAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTV
VKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLALQGQMAAATAEPEEIGFQIR
TRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQA
CITAATAVSGIIADLDTTIMFATAGTLNAENGETFADHRENILKTAKALVEDTKLLVSGA
ASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGA
TKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQEL
TVFQSKDIPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLI
ACKQASFYPDVSEEVRTRALRYGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFSKRVA
GAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADE
TLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAA
RMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQ
VMVTDAGGKILLLERAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIA
AQEEMLKKERELEEARKKLAQIRQQQYKFLPTELREDEG
NT seq 7680 nt   +upstreamnt  +downstreamnt
atgaaaatggtggccctatccttaaagatctgtgtccgccactgcaatgtggtgaagacc
atgcagtttgagccgtctacagctgtgtatgacgcctgtcgagtcattcgggagagagta
cctgaagcacagaccgggcaagcttctgactatggactgtttctttctgatgaagacccc
aggaaagggatttggctagaagcaggtcggacactggattactacatgttgcggaatggg
gacattctggagtacaagaagaaacagaggcctcagaaaatccgaatgttggatggctct
gtgaagacggtgatggtggatgactccaagaccgtgggggagctcctggtcacaatctgc
agcaggataggaataacaaattatgaagaatactctttaatccaagaaaccattgaagaa
aagaaagaagaagggacaggcacactaagaaaagacaggacgttgttacgagatgagagg
aagatggagaagctgaaagccaagctacacacggatgatgacctaaattggctagatcac
agccggacattcagagagcaaggcgtggatgaaaatgaaacattgctacttcgacggaag
ttcttttactctgatcagaatgtggactcaagagacccagtacagttgaacttgctttac
gtccaggctcgggatgacatcctgaacggctctcaccctgtctccttcgagaaggcatgt
gagtttggtgggttccaagcccagatacagtttggacctcacgtggaacataaacacaag
cctggattcttagatctaaaggaattcctgcccaaagagtacatcaagcagagaggagcc
gagaagcgaatatttcaggaacataaaaactgtggagagatgagtgaaatagaagccaag
gtgaagtacgtgaaactcgcccgatccctccggacatatggagtgtccttttttctggtg
aaggaaaaaatgaaaggcaagaacaagctggttccccgcctcctgggcatcaccaaggac
tctgtcatgcgtgtggatgagaagaccaaggaggtgctgcaggagtggccactcaccacg
gtcaagcgctgggcagcttcacctaagagcttcacactggattttggggagtaccaagaa
agctactattcagtacagaccacagagggggagcaaatatcccagctgattgcaggatac
attgacatcatcctcaagaagaaacaaagcaaagatagatttgggctggaaggggatgag
gagtcaactatgttagaagagtcagtttccccaaaaaaatctaccatcttgcagcagcag
ttcaaccgcactgggaaggcagagcatggctcggtggcactgccagctgtcatgcgctct
ggctccagtgggcccgagactttcaatgttggcagcatgccgtccccccagcagcaagtc
atggtcggacagatgcaccgaggacacatgcctccgctgacttcggcacagcaagccctt
atggggaccatcaacacaagcatgcacgctgtccagcaggctcaggatgacctcagtgag
ctcgactcactgccacctctcggccaagatatggcatctagggtatgggttcagaacaaa
gtggatgaatccaagcatgaaatccactctcaagtcgatgctatcacagctggcacagcc
tcggttgtcaacctcacagctggtgaccccgcagacactgactacacagccgtgggctgt
gcaatcactacaatttcttccaacctgaccgaaatgtccaagggggtcaagttgctggca
gccctcatggacgatgacgtgggcagtggggaggaccttctcagagctgccaggaccctc
gccggggctgtgtctgatttactgaaggctgtgcagcctacttctggagagcctcgacag
actgttttgactgctgcgggaagcatcggccaagccagtggagatctcctgagacagatc
ggagagaacgagacggacgagagattccaagatgttttaatgagtctcgctaaagctgtt
gccaacgctgctgccatgttagtactcaaggcgaagaatgtggcccaggtggctgaagac
accgtcctccagaacagggtgatcgccgcagccacccagtgtgccctctccacctcgcag
cttgtggcgtgtgctaaggtggtgagccccacgatcagctcccccgtgtgccaggagcag
ctgatcgaagctgggaagctggtggaccgctctgtggaaaactgtgtccgtgcctgccag
gcggccaccggtgacagtgagctcctgaagcaggtcagcgcggcggccagcgtggtcagc
caggccctgcacgacctcctgcagcacgtgcggcagttcgccagccggggcgagcccatc
ggccgctatgaccaggccaccgacaccatcatgtgtgtcactgagagcatcttcagttcc
atgggggatgctggtgagatggtgcgccaagcccgggtgctggcccaggccacatcagat
ctcgtcaatgccatgaggtcagatgcggaggctgagattgacatggagaattccaagaag
ctcctggcagccgcaaagctcttggccgactccaccgcccgcatggtggaagctgcaaag
ggggctgcagccaacccggagaacgaagaccagcagcaaaggctgagagaagctgccgag
ggtctccgggtagcaaccaacgccgctgcccagaacgctattaagaaaaaaatcgtcaac
cggctggaggttgcagccaagcaggctgcagctgctgccacacagaccattgcagcctcc
cagaatgcagccatctccaacaagaacccctcggcccagcagcaactggtgcagagctgc
aagacggtggctgatcacatccctcagctagtgcagggggtgagggggagccaagctcaa
gcagaagacctcagcgcccagctggccctcatcatctccagtcagaacttcctgcagcct
ggaagcaagatggtgtcctctgctaaggcggccgtacccactgtgagtgaccaggccgca
gccatgcagctgagtcagtgcgccaagaacctggcgacaagccttgctgagctgcgcact
gcctcacagaaggcccatgaagcctgtggtcccatggaaatcgattctgcactgaacaca
gtgcagactctcaagagtgagcttcaggacgccaagatggccgctgcagaaagtcaactg
aaaccacttccaggagaaacactagaaaagtgcgctcaggacctgggaagcacctctaag
ggagtgggctcctccatggcgcagctcctcacctgcgctgctcaaggcaatgagcactac
acaggcgtggcagctagagaaacagctcaagctctgaaaacactggcccaggctgcccgg
ggagtggctgcgtctacaaatgaccctgaggccgctcatgccatgttagactctgctcgg
gatgtgatggagggctctgccatgctcatccaagaagccaagcaggccttaatcgcacct
ggagatacggaaagtcagcagagattagcccaggtggccaaagctgtgtcccactcactg
aataactgcgtgaattgcctccctggtcagaaggatgtggatgtcgccttgaagagcatc
ggggagtccagcaagaagctacttgtagattcgctccctccgagcacaaagcctttccag
gaagcccagagtgagctgaaccaggctgctgctgatctgaaccagtctgccggggaagtc
gtccatgccacaagggggcagagtggagagctggcggccgcttctgggaagttcagtgat
gactttgacgagttcctggatgcaggcattgagatggctggccaggcacagacaaaagaa
gaccagatgcaagtgatcgggaacctgaagaacatctctatggcgtccagcaagctactg
ttagctgccaagtctctctctgtagatcctggagctcccaacgcaaaaaatcttttggct
gcggctgcaagagctgtgacagagagcatcaatcagctcatcatgctgtgcactcagcag
gcccccgggcagaaggagtgtgacaatgcccttcgtgagctcgagactgtcaaggggatg
ttggaaaaccctaatgagccagtgagcgacctctcttactttgactgcattgagagtgta
atggagaactccaaggttctgggcgagtcaatggcagggatttcacagaatgccaaaact
ggagacctccctgccttcggagaatgcgtggggattgcatccaaggctctctgtgggctg
acagaggcagcagcccaggctgcgtacctggttggcatctctgatccaaacagccaggca
ggccaccaaggcctagtggaccccatccagtttgccagggccaaccaggcgatccagatg
gcatgccagaacttggtggaccctggcagcagcccatcacaggttctgtcagctgctacc
attgttgccaagcacacctcagccttatgcaatgcctgccgcatcgcctcgtctaagaca
gccaaccctgtggccaagaggcactttgtccagtcagccaaggaggtggccaacagcacc
gccaacctggtcaagaccatcaaggccctggatggggatttctctgaagacaaccgcaat
aagtgtcgaattgctaccacgccgttgatcgaggctgtggagaacctgacagcatttgca
tcaaaccccgagtttgccagcattcctgcacagatcagctctgagggctcccaggcacag
gaaccaatcttggtctcagccaagaccatgctggagagctcatcgtacctcatccgcacc
gcacgctctctggccatcaaccccaaggatccacccacctggtctgtgttggctgggcac
tctcacactgtgtctgactccattaagagtctcatcacgtctatcagggacaaagcccca
gggcagagggaatgtgactactccattgatggcatcaaccggtgcatcagggacatcgag
caggcctccctggcggcagtgagccagagcctggccacgagggatgacatctctgtggag
gccctacaggagcagctgacctcggtggtccaggaaatagggcatcttattgatcccatt
gccacagcagcacgaggagaagctgcccaacttggacataaggtgacacagctggcaagc
tactttgagccattgatcttagctgcagtcggtgtcgcctccaagatgctggaccatcaa
caacagatgacagtgctagaccagaccaaaactctcgcagagtctgccctgcagatgctg
tatgcagccaaagaaggtggaggaaaccccaaggcacagcacacccacgacgccatcaca
gaggctgcacagctgatgaaggaagctgtggatgacattatggtgacgctgaatgaagct
gccagtgaggtggggctggtgggaggcatggtagacgccatcgcagaggccatgagcaag
ctggatgaaggcacacctccagaaccaaagggaacgtttgttgactaccagacgactgtg
gttaaatactccaaagccattgccgtcacagctcaggaaatgatgactaagtcggttact
aacccggaggagttgggaggcctggcttcacaaatgaccactgactatgggcacctggct
ctccagggccagatggcagcagccaccgccgaaccagaggagattggattccagattcgc
acacgcgtgcaggaccttggccatggctgtatcttcctggtgcagaaggcgggggccctc
caggtttgccccacagacagctacaccaagagggagctgatcgagtgtgcccgttctgtc
accgagaaggtatccttggtgctgtctgctctccaggctgggaacaaggggacccaggca
tgcatcaccgctgcaactgcagtttctgggatcattgctgatctggacaccaccattatg
tttgcaacagctgggacgctgaatgctgaaaatggcgagacctttgccgatcacagggag
aacattctgaagacagccaaggccttggtggaagacacaaagctgcttgtgtcgggggcc
gcatccactccagacaagctggcccaggcagctcagtcctcagcagcaaccatcacccag
cttgccgaggtggtcaagctgggggccgccagcctgggctccaatgaccctgagacccag
gtggtactgataaatgccatcaaagacgtggccaaggccctttccgatctcattggtgct
accaagggagctgccagcaagccagctgatgacccctccatgtaccagctcaagggagcc
gccaaggtgatggtgaccaatgtcacctcccttcttaagactgtgaaggcagtggaagac
gaggccacccggggcacaagggcacttgaggccaccatcgagtacataaaacaggagctc
acagtgttccagtcaaaagacatacctgagaagacatcatcacccgaggaatcaataaga
atgacgaaaggtatcaccatggcaacagccaaagctgtggcagccgggaactcatgtaga
caagaggatgtgattgccaccgccaatctgagcaggaaggctgtctcagatatgttgata
gcttgcaagcaagcatccttctaccctgatgtcagtgaagaggtgcgaaccagagccttg
cggtatggcacggagtgcaccctgggctacctggacctactagaacacgtcttggtgatt
cttcagaagccaaccccagaactcaagcatcagctggctgctttctccaaaagagttgcc
ggtgctgtgactgagctcatccaggcagcagaagccatgaaaggaacagagtgggtggat
ccagaagacccaaccgtcattgcagaaaccgagttactgggagctgcagcatccattgaa
gccgctgccaagaagttagagcaactgaagccgagagcaaagccaaagcaagcagacgag
accctggattttgaagaacagatcttagaagctgctaaatccattgctgctgccacaagt
gccctggtcaagtcggcctcagcggcccagagggagctggtggcccaaggcaaggtgggc
tccatccctgccaatgccgccgatgatggacagtggtcacaggggctgatctctgccgcc
cggatggtggcagcagcaaccagcagtctctgtgaggcagccaatgcctctgttcaggga
catgccagtgaggaaaagctcatctcatctgccaagcaggtcgcagcctcaaccgctcag
ctgctggtggcctgcaaggtgaaggccgaccaggattcagaggccatgaagcggctacag
gtaatggtcactgatgctggtgggaaaatactcctgttggagcgggcggcaggaaatgct
gtgaaaagagcctcagacaatcttgttcgtgcagcccagaaggcagcatttggcaaagct
gatgatgacgatgttgtggtgaaaaccaagtttgtgggaggcattgctcagatcattgca
gcccaggaggaaatgctgaagaaagaacgagagctggaggaagccaggaagaagctggcc
cagatccgccagcagcagtacaaattcctacccacagagctgagagaagatgagggctag

DBGET integrated database retrieval system