KEGG   Rattus norvegicus (rat): 313529
Entry
313529            CDS       T01003                                 

Gene name
Tmem53, RGD1307066
Definition
(RefSeq) transmembrane protein 53
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF829
Other DBs
NCBI-GeneID: 313529
NCBI-ProteinID: NP_001101434
RGD: 1307066
Ensembl: ENSRNOG00000019186
UniProt: D3ZPB8
Position
5q36
AA seq 276 aa
MASAELDYSIEIPDQPCWSQKNSQGGKEAGKQQPVVILLGWGGCRDKNLAKYSAIYHKRG
CIVIRYTAPWHMVFFSESLGIPSLRVVAQKLLELLFDYEIEREPLLFHVFSNAGVMLYRY
VLELLQTHQRFRHLHVVGTIFDSGPGDSDLIGALRALATILERRPAVLRLLLLAAFALVV
VLFHFLFAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKVVSARDVERMVEERLAHQVS
VRGVDFVTSAHVSHLRDYPTYYTSLCVDFMHNCVQC
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcctcggccgagctggattacagcatcgagatcccggatcagccctgctggagccag
aagaacagccaaggtgggaaggaggccgggaagcaacagcctgtggtgattctcttgggc
tggggtggctgcagggacaagaacctggccaagtatagtgccatctaccacaaaaggggc
tgcattgtgatccgatacacggccccctggcacatggtcttcttctctgagtccttgggc
attccctcacttcgtgtggtggcccagaagctgcttgagctcctctttgactatgagatt
gagcgggagcctctgcttttccatgtcttcagcaatgccggcgtcatgctctaccgctac
gtgctggagctccttcagacccatcagcgcttccgccatttgcatgtggtgggcaccatc
tttgacagtggccctggggatagcgacctgataggggccctgagggccctggcaaccatc
ctggagcgcagacctgccgtgcttcgcctgttgctcctggcagcatttgcgctggtggtg
gtcctgttccacttcctgtttgctccattcacggccctcttccacacccacttctacgac
aggctgcaggattcaggctcctgctggcccgagctctacctctactctagagctgataag
gtggtctcagccagggatgtggaacggatggtggaggaacgcctggctcaccaggtctca
gtgcgcggagtggacttcgtgacatctgcgcatgtcagccacctccgagactatcctact
tactatacaagtctgtgtgttgacttcatgcataattgtgtccagtgctga

DBGET integrated database retrieval system