KEGG   Rattus norvegicus (rat): 313535
Entry
313535            CDS       T01003                                 

Gene name
Eri3, Prnpip1
Definition
(RefSeq) ERI1 exoribonuclease family member 3
  KO
K18418  ERI1 exoribonuclease 3 [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313535 (Eri3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     313535 (Eri3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RNA interference (RNAi) pathway
    Other RNAi proteins
     313535 (Eri3)
SSDB
Motif
Pfam: RNase_T
Other DBs
NCBI-GeneID: 313535
NCBI-ProteinID: XP_001071982
RGD: 1595859
Ensembl: ENSRNOG00000019381
Vega: OTTRNOG00000002342
UniProt: M0R8C5
Position
5q36
AA seq 337 aa
MATASPAADGGRGRPWEGGLVSWPPAPPLTLPWTWMGPSWGQHPGHWGFPALTDPSASPA
ASLGIFEVRRVLDASGCSMLAPLQTGAARFSSYLLSRARKVLGSHLFSPCGVPEFCSIST
RKLAAHGFGASMAAMVPFPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEI
ESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKS
IFVTCGDWDLKVMLPGQCHYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSL
QHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgacagcctctccggcagctgacggggggcgggggcggccttgggaaggagggctg
gtctcctggccccctgcccctccccttacgctcccctggacctggatgggcccgagctgg
gggcaacaccctgggcattggggctttccagctctcacagacccatcagcatctccagct
gccagtcttggcatcttcgaagtaaggagagttttagatgcctctggatgttcaatgcta
gcacctttacagactggagcagctcgattttcttcatatttactttcaagagcaagaaaa
gtgctgggctcccacttattttctccctgtggtgttccggagttctgttccatatccacc
agaaagctggcggcccacggctttggcgcgtcaatggcggcaatggtgcccttccctccc
cagaggtatcactactttttagtgctggactttgaggccacatgcgacaagccacagatt
catcctcaggaaatcattgagttccccatcctgaagttaaatggccggaccatggaaatt
gagtctacctttcacatgtatgtccagcctgtagtccacccacagcttacccccttctgt
acagagctcactgggatcattcaagccatggtggatggccagccaagcctgcagcaagtg
ctggagagggtcgatgagtggatggcgaaggaaggcctcttagatcccaacgtcaagtca
atctttgtcacctgtggagactgggacttgaaagtcatgcttccaggccagtgccattat
ttaggcttgccagtggcggattacttcaagcagtggattaatctaaaaaaggcttacagc
ttcgccatgggctgctggcccaagaatggactactagacatgaacaagggcctcagcctg
caacacataggccggccccacagcggcattgatgattgcaagaacattgccaacatcatg
aagacattggcataccgaggcttcatcttcaagcagacatcaaagcccttctga

DBGET integrated database retrieval system