KEGG   Rattus norvegicus (rat): 313574
Entry
313574            CDS       T01003                                 

Gene name
Nt5c1a
Definition
(RefSeq) 5'-nucleotidase, cytosolic IA
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    313574 (Nt5c1a)
   00240 Pyrimidine metabolism
    313574 (Nt5c1a)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    313574 (Nt5c1a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     313574 (Nt5c1a)
SSDB
Motif
Pfam: 5-nucleotidase OB_RNB
Other DBs
NCBI-GeneID: 313574
NCBI-ProteinID: NP_001101446
RGD: 1310908
Ensembl: ENSRNOG00000015283
UniProt: D3ZVD3
Position
5q36
AA seq 362 aa
MEPRQPPEAREPGPGAETAAVPRWEEAKTFYDNLSPKKKPKSPKPQNAVTIAVSSRALFR
MDEEQRIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNKQLRELYPDSEDIFDI
VLMTNNHAQVGVRLINSINHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAI
DEGIAAATIFSPSKDVVVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAHENK
PLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWGLET
DEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGVAQNPRREKQSLG
AQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggaaccaaggcagcccccggaggcccgagaacccggaccaggggcagagaccgccgcg
gtgccgcgctgggaggaagccaagacgttctatgacaatctctcgcccaagaagaaaccc
aaatcgccaaagcctcagaatgcggtcaccatcgcagtgtcctccagagccttgttccga
atggatgaggaacagaggatctacacggagcagggtgtagaggagtacgtacgataccag
ctggagcacgagaacgagcccttcagccctgggcccgccttcccctttgtaaaggccctg
gaggctgtgaacaagcaacttcgagagctgtaccccgatagcgaagatatctttgacatc
gtcctcatgaccaacaaccatgctcaggtgggggttcgtctcatcaacagtatcaaccat
tacgacctgttcattgagcgattctgcatgacaggtgggaatagccccatctgctacctc
aaggcctaccataccaacctctacttgtcagccgatgcagaaaaagtgcgagaagccatt
gatgaggggattgcagctgccaccatcttcagccctagcaaggatgtggtcgtgtcccag
agtcagctccgcgtggccttcgatggggacgcagtacttttctccgatgagtcagagcgc
attgtcaaggcccatgggctggacagattctttgagcatgagaaggcccacgagaacaaa
cctttggcgcagggtcccctaaagggcttcctggaagcactaggtaggctgcagaagaaa
ttctactccaaaggcctgcggctggagtgcccgattcgtacttacttggtgacagcgcgc
agcgcagccagttctggagcccgggccctcaagaccctacgtagctggggcctggagacg
gatgaggccttattcctagctggagcacccaagggccctcttcttgagaagatccgccca
cacatcttctttgatgaccagatgtttcacgtggccggagctcaggagatgggcaccgtg
gccgcccacgtgccttacggcgtagctcagaatccacggagggaaaagcagtccctaggc
gcacagtag

DBGET integrated database retrieval system