KEGG   Rattus norvegicus (rat): 313575Help
Entry
313575            CDS       T01003                                 

Gene name
Heyl
Definition
(RefSeq) hes-related family bHLH transcription factor with YRPW motif-like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    313575 (Heyl)
  09162 Cancer: specific types
   05224 Breast cancer
    313575 (Heyl)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    313575 (Heyl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    313575 (Heyl)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    313575 (Heyl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange
Motif
Other DBs
NCBI-GeneID: 313575
NCBI-ProteinID: NP_001101447
RGD: 1305022
Ensembl: ENSRNOG00000015318
UniProt: D3ZIH3
Position
5q36
AA seq 326 aa AA seqDB search
MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGAGFFDARALAVDFRSIG
FRECLTEVVRYLGVLEGPSSHADPVRIRLLSHLNSYAAEMEPSPTTTGALAFPVWPWSFL
HSCPGLPSLSSQLAILGRVPGPVLPNVSSPPYPISALRSAPVHRVPGTIPPAQRNLLPSR
GVTSSQRAHPPERPAAPPPTALGVRAARSIVPILPCSSPAAPGAGKSDDSASGSISSPSP
LGPTGRPAGAVFYHSWVSEITEIGAF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcccagggcgcccagtggctccgacggcgagtctgatggacccatcgacgtg
ggtcaggagaacgatcttagccagatggccagaccgctgaccacccccagcccttcgcag
atgcaagcccggaagaagcgcagagggatcatagagaaacggcgccgagaccgcatcaac
agcagcctgtctgaactgcgacgattggtccccactgcctttgagaaacagggctcctct
aagctggagaaagctgaggttttgcagatgaccgtggatcacttgaagatgctccatgcc
tctggtggcgcagggttctttgatgcccgagccctggctgttgacttccggagcattggt
tttcgggaatgccttactgaggtcgtaagatacctgggggtcctggaaggacccagcagc
catgcagaccccgtccggattcgcctcctctcccacctcaacagctatgcagcagagatg
gaaccctcgcccacaaccaccggtgccctggcctttcccgtgtggccctggtccttcctc
catagctgtccaggcttgccttccctgagcagtcagctagccatcctgggaagagtgccc
ggccccgtccttcccaatgtctcttctcccccttacccgatctcagccctgcggtccgca
ccagtgcacagagttcctggtaccattcccccagcccagcggaatttgctgcccagccga
ggggtgacttcctcccagagagcccaccctcctgagaggccagctgcccctccacccaca
gccctaggtgtcagggccgccaggagcatagtccccatcctgccgtgttcctccccagca
gcccctggagctgggaaatctgatgacagtgcgtctggttctatctctagtccgtctcct
ttgggaccaacggggaggcctgcgggagcagtgttctaccactcctgggtatcagaaatc
actgaaattggggctttctga

DBGET integrated database retrieval system