KEGG   Rattus norvegicus (rat): 313583Help
Entry
313583            CDS       T01003                                 

Gene name
Sf3a3, LRRGT00093
Definition
(RefSeq) splicing factor 3a, subunit 3
  KO
K12827  splicing factor 3A subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    313583 (Sf3a3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    313583 (Sf3a3)
Spliceosome [BR:rno03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    313583 (Sf3a3)
 Complex B
    313583 (Sf3a3)
 Complex C
   U2 SnRNP specific factors
    313583 (Sf3a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3449 Telomere_Sde2_2 SF3A3 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 313583
NCBI-ProteinID: NP_001020869
RGD: 1308726
Ensembl: ENSRNOG00000007629
UniProt: Q4KLI7
Position
5q36
AA seq 501 aa AA seqDB search
METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDL
YDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENP
SEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNA
EYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQTDFEKKWDNGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSL
FAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRQLTHENVQRKQARTGEEREEEE
EEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagacaattttagagcagcaacggcgctatcatgaggagaaagaacggcttatggat
gttatggccaaagaaatgctcactaagaagtccacgctccgggaccagatcaattccgat
caccgcactagggccatgcaagatagatacatggaggtcagtgggaacctgagggatttg
tatgatgataaggatggattacgaaaggaggagctcaatgctatttcaggacccaatgag
tttgctgaattctataacagactgaagcagataaaggaatttcatcggaagcacccaaat
gagatctgtgtgccaatgtcggtggaattcgaggagctcctgaaagctcgagagaatcca
agtgaagaggcacaaaacttggtggagtttacagatgaagagggatatggtcgctacctt
gatctccatgactgctacctcaagtacattaacctgaaggcatctgagaagctggattac
atcacatacctgtccatcttcgatcagttatttgacattccgaaagaaagaaagaatgca
gagtataaaagatacctggagatgctgctggagtacctacaggattacacagatagagtg
aagccccttcaggatcagaacgagctctttgggaagattcagaccgactttgagaagaag
tgggataatggcaccttccctggatggccgaaagagacaagcagtgccctgactcacgcg
ggagcccatcttgatctctccgcattctcctcctgggaggagttggcatccctgggtctg
gacagattgaaatctgcactgttggctttaggcctgaagtgtggtgggaccctagaagaa
cgagctcagagactcttcagcaccaaaggaaagtccttggagtcgctcgacacctctctg
tttgccaaaaatcccaagtcaaagggcacaaagagagacactgagaggaacaaagacatt
gctttcctggaagcccagatctatgaatatgtggagattcttggggaacagcgacagctc
actcatgaaaatgtacagcgcaagcaagccaggacaggtgaggagcgggaggaggaggaa
gaagagcagatcagcgagagcgaaagtgaggacgaagagaatgaaatcatttacaacccc
aaaaacctgcctctgggctgggacggcaaacccatcccctactggctgtacaagctccac
ggcctgaacatcaactacaactgtgagatctgcgggaactacacttaccgagggccgaag
gccttccagcggcacttcgctgaatggcgtcatgctcatggcatgaggtgtttgggcatc
ccaaacactgcccactttgcaaatgtgacacagattgaagatgctgtctccttgtgggcc
aagctgaaactgcagaaggcttcagaacgatggcagcctgacaccgaggaagaatatgaa
gactccagtggaaatgttgtgaacaagaagacatacgaggatctgaaaagacaaggactg
ctctag

DBGET integrated database retrieval system