KEGG   Rattus norvegicus (rat): 313620
Entry
313620            CDS       T01003                                 

Gene name
Srrm1
Definition
(RefSeq) serine/arginine repetitive matrix protein 1
  KO
K13171  serine/arginine repetitive matrix protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    313620 (Srrm1)
   03015 mRNA surveillance pathway
    313620 (Srrm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    313620 (Srrm1)
   03041 Spliceosome [BR:rno03041]
    313620 (Srrm1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     313620 (Srrm1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    313620 (Srrm1)
SSDB
Motif
Pfam: PWI
Other DBs
NCBI-GeneID: 313620
NCBI-ProteinID: NP_001101456
RGD: 1311258
Ensembl: ENSRNOG00000018194
UniProt: B2RYB3
Position
5
AA seq 908 aa
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASLKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKSPELPEPSVRMKDSSVQEATS
TSDILKAPKPEPVPEPKEPSPEKNSKKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRH
RSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPGRRRRRSSASLSGSSSSS
SSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSSPATPPPKTRHSPTPQQSNR
ARKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGSKMAAADSVQQR
RQYRRQNQQSSSDSGSSSTSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSP
RSRRRRSPSPPPARRRRSPSPAPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRY
SPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSPPVTKRRSPSL
SSKHRKGSSPGRSTREARSPQPNKRHSPSPRPRAPQTSSPPPVRRGASASPQGRQSPSPS
TRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPTAKKPPAPPSPVQSQSPS
TNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAV
AVATPAPAAPAAVSAAATPSAQEEPAAAPEPRKETESEAEDDNLDDLERHLREKALRSMR
KAQVSPQS
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggacgcgggattcttccgcggaacaagtgcggagcaggataatcgattcagcaacaaa
cagaagaaactcctcaagcagctgaaatttgcagaatgtctagaaaaaaaggtggacatg
agcaaagtaaatttggaggttataaagccttggataacaaaaagagtgactgagatcctt
ggattcgaagatgatgttgtgattgagtttatattcaaccagctggaagtgaagaaccca
gattccaaaatgatgcaaatcaacctgactggatttttgaatgggaagaatgctagagag
ttcatgggagaactgtggcctctgctgttaagtgcacaagaaaatatcgccggaatccct
tctgctttcctagagttgaagaaggaagagataaagcagagacaaattgaacaagaaaaa
ttggcgtctctgaaaaaacaagatgaagataaagataagagggataaggaagaaaaagaa
agcagcagagagaagagggagcggtctcgcagcccaagaagacgcaaatccagatctcct
tcccctagaagacgatcttcccctgtcaggagagagagaaagcgcagtcactctcgatct
ccccgtcacagaaccaagagccggagcccttcccctgccccagaaaagaaggagaaatct
ccagagctcccagaaccatcagtgagaatgaaagactcttcagtacaagaggccacatct
acaagtgacatcttgaaagctcccaagcctgagcctgtaccagagcccaaagaaccatct
ccagaaaaaaattccaaaaaggaaaaggaaaagactcgaccaagatctcggtcacgttcc
aaatcacggtcccggactcgttctcggtcaccttctcatacgagacccagacggcgacat
agatcccgatcaagatcatactctcctagaaggcgaccaagccccagacgacgaccatct
ccccgaagaagaactccaccaagacggatgcctcctccaccacggcacaggaggagtagg
tctccagggagacgaaggagacgttcttccgcatcgctgtctggaagtagctcgtcgtcc
tcttcatctcgttcccggtcaccgccaaagaagcctcccaagaggacatccagccctcct
cggaaaactcgtaggttatcaccttcggcaagtcctccgaggcgaaggcaccggccgtca
tctccagcaactccgccacccaaaactcgccattccccaactccccagcagtcaaaccgt
gcaagaaaaagtcgtgtgtctgtgtctccaggaagaacctcgggtaaagtgacaaaacat
aaaggcactgagaaaagagagtcaccttctccagcacccaagcctagaaaagtggagctg
tctgagtctgaggaagacaaaggcagcaaaatggctgcagctgattctgtgcagcagagg
cgacaatatagacgacagaaccagcagtcttcatctgactctggctcctcttccacctca
gaagatgagcggcccaagagatcccatgtgaagaatggtgaggtaggcaggcggcggaga
cattctccttctcggagtgcctctccatcacctcgaaagcgccaaaaagagacttcccct
cgtagtagaaggaggagaagtccttccccacctcctgccagaagacgacgatctccttct
ccagcccctcctccccctcctcccccacctcctcggcggcgcagatctcccaccccacca
ccacgacgaaggaccccttctcctcccccacgccgccgctcaccgtctccaagaagatac
tctcctcccatccagaggagatactctccttccccacctccaaagaggagaactgcctcg
cccccacccccacccaagcgaagggcatcgccatctcctccaccaaagcgccgggtttcc
cactctccacctcctaaacaaagaagccccccagtcaccaagagacgctcaccctcctta
tcttcaaagcataggaaagggtcttccccaggccgctccactcgggaggcccggtcacca
caaccaaacaaaaggcactcgccctcaccacgacctcgggcgcctcagacctcaagccct
ccccctgttcgaagaggagcttcagcgtctccccaaggaaggcagtccccgtctccgagt
actaggcctattaggagagtctccaggactccggaacccaaaaagataaaaaaggctgcc
tcaccaagccctcagtccgtaagaagggtttcatcttcccgctctgtctctggatctcct
gagccaacagctaaaaagcctccagcacccccctctcctgtgcagtctcagtcaccctcc
acaaactggtcacctgcagcaccagccaagaaggctaaaagcccaacaccaagcccgtcc
cctgccaggaattctgatcaagaaggaggtggaaagaagaagaagaagaagaaggacaag
aaacataagaaggataagaaacacaagaagcacaaaaaacacaagaaggagaaggctgtg
gccgtagccaccccagctcctgctgcccctgcagctgtctctgctgccgccactccatca
gcccaggaagagcctgcggcagcaccagagcccaggaaggagactgagagtgaagctgaa
gatgacaaccttgatgacttagagaggcaccttcgggagaaggcccttcgatccatgcgg
aaggcccaagtgtccccacagtcctag

DBGET integrated database retrieval system