KEGG   Rattus norvegicus (rat): 313644
Entry
313644            CDS       T01003                                 

Gene name
Rap1gap
Definition
(RefSeq) rap1 GTPase-activating protein 1
  KO
K17700  RAP1 GTPase activating protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    313644 (Rap1gap)
SSDB
Motif
Pfam: Rap_GAP GoLoco
Other DBs
NCBI-GeneID: 313644
NCBI-ProteinID: NP_001094183
RGD: 1309908
Ensembl: ENSRNOG00000013825
UniProt: F1LV89 Q5EB70
Position
5
AA seq 753 aa
MSGRKRSFTFGAYGGVDKSFSPRQSVWRSDGQKHSFPQTLNVLLVDSVPSHPASPYPKNT
DLFEMIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWI
EGTNHEISSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSL
KYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPK
ASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDF
KGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVV
FQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFR
KGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDDD
KMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFTPNNPDLAKAAGI
SLLIPGKSASRFGRRGSALGIGAVEESLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQ
EKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRVESAAQRTEVLQGFSRSSS
SASSFTSVVEETEGVDGDDTGMESVSSSGTPHKRDSFLYSTWLDDSVSTTSGGSSPGLTR
SPHPDAVKSGDPACPEIKIQLETSEQHTPQMGC
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgagcggccggaagcgcagcttcaccttcggtgcctatggaggggtggacaaatccttc
tctcctcgacagagtgtgtggaggagtgatggacagaaacacagcttccctcagacactg
aacgtgttactagtggactcagttccctcccaccctgcttcaccctaccctaagaacaca
gatctgtttgagatgattgaaaagatgcagggaagcaggatggatgaacaacgatgctcc
ttcccgccacccctcaagacggaggaggactacattccctacccaagtgtccatgaggtt
ttggggcgagaagggcccttccccctcatcctgctgccccagtttgggggctactggatt
gaaggcaccaaccatgaaatcagcagtatccccgagacagagccgctgcagtctcccacc
accaaggtcaagctggagtgcaaccccacagccagaatctaccggaagcactttctcggc
aaggagcacttcaattactactcgctggacactgctctcggccacctggtcttctcgctc
aagtatgatgtcatcggggatcaagagcacctgaggctattgcttaggaccaagtgtcgg
acctaccatgatgtcatccccatctcctgcctcaccgagttccccaacgtggtccagatg
gcaaagttggtatgtgaagatgtcaacgtggatcgattctaccccgtgctttatcctaag
gcttccagactcatcgtcacctttgacgagcatgttatcagcaataacttcaagttcgga
gtcatctatcagaagctggggcagacatccgaggaggaactgttcagcaccaacgaggaa
agtcctgcctttgtggaattcctcgagtttctgggccagaaagtcaaactgcaggatttc
aaggggttccgaggaggcctggacgtgactcacgggcagaccgggaccgagtccgtctac
tgcaacttccgcaacaaggagatcatgtttcatgtgtccaccaagctgccatacacagaa
ggggacgcccagcagttgcagcggaaacggcacatcgggaacgacatcgtcgccgtggtc
ttccaggacgaaaacacgcccttcgtgccagacatgattgcttccaacttcctgcatgcc
tatgtggtggtgcaggcagaggggggtggccccgatggccccctctacaaggtctcagtc
accgcgagagacgatgtgccctttttcgggcctcccctcccagatcctgctgtgttcagg
aaggggcctgagttccaggaatttcttctgacaaagttgatcaacgctgagtacgcctgc
tacaaagcagagaagtttgccaaactggaggagcggacacgtgctgcccttctggagaca
ctctacgaggagctccacatccacagccagtccatgatgggcctgggtggtgacgatgac
aagatggagaatggcagcggtgggggtggcttcttcgagtctttcaagagggtcatccgg
agccggagccagtccatggatgccatgggactgagcaacaagaaacccaacaccgtgtct
accagccacagtgggagcttcacccccaacaacccggacctggccaaggcagctggcata
tcattgcttattcccgggaaaagcgcgagtagattcggacgccggggcagcgccttaggc
ataggagctgtggaagagtccctgattgtccctggaaagagtcccacaaggaagaagtct
ggtccatttggctcacgccgcagcagcgccattggcatcgagaacatccaggaggtgcag
gagaagagggagagccctccagctggccagaagaccccagacagcgggcatgtctctcag
gagcccaagtcggagaactcatctactcagagctccccagagatgcccacgaccaagaac
agagtggagtcggctgcccagagaacggaagtgctgcaaggcttttccagatcctcctcc
agtgccagcagcttcaccagcgtggtggaggagacggagggcgtggatggagatgataca
ggcatggagagcgtgtcgtcctcaggaacgccccataagcgggactccttcctctacagc
acatggctggacgacagcgtgagcaccacgagcgggggcagctccccaggcctcacacgg
tcaccccacccagacgccgtcaagtcgggggaccctgcgtgtcccgagatcaagatccaa
ctggaaacatctgagcagcacacaccccagatgggctgctag

DBGET integrated database retrieval system