KEGG   Rattus norvegicus (rat): 313702Help
Entry
313702            CDS       T01003                                 

Gene name
Mad2l2
Definition
(RefSeq) MAD2 mitotic arrest deficient-like 2 (yeast)
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05100  Bacterial invasion of epithelial cells
Module
rno_M00293  DNA polymerase zeta complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313702 (Mad2l2)
   04114 Oocyte meiosis
    313702 (Mad2l2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    313702 (Mad2l2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    313702 (Mad2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313702 (Mad2l2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     313702 (Mad2l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA
Motif
Other DBs
NCBI-GeneID: 313702
NCBI-ProteinID: NP_001012106
RGD: 1307499
Ensembl: ENSRNOG00000009134
Vega: OTTRNOG00000000755
UniProt: D3Z8D9
Position
5q36
AA seq 234 aa AA seqDB search
MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIKLGGLKQTVS
LTVLGSWRYADLSGTLGVLSTAEYLSDLKGPLYPTSIQSVQTPSCLMWSSCFEPSFLRLV
CVTLSSTIILQAARLQFSCTQEKLPLGTWRRYRSSRTSPGSWQMSKMSTCMIPG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcacgcgccaagacctcaacttcggccaagtggtggccgacgtgctctcc
gagttcctggaggtggccgtgcacttgatcctctatgtgcgcgaggtctacccggtgggc
atctttcagaagcgcaagaagtacaacgtgccggttcagatgtcctgccacccagagctg
aaccagtacatccaggacacacttcactgcgtcaaaccactcctggagaagaacgatgtg
gagaaggtggtggtggtgattttggataaggaacaccgcccagtggagaagtttgtcttt
gagatcactcagccacccttgctgtccatcaagctaggtggcctcaaacagaccgtttct
ctaactgtcttggggtcctggaggtatgcagacttgagcggtaccctgggtgtcctctcg
acagctgaatatttgagtgacctaaagggacctttgtaccctacctctattcagtcagtt
cagactccctcctgtctcatgtggagcagctgcttcgagccttcattcttaagattagtg
tgtgtgacgctgtcctcgaccataatcctccaggctgcacgtttacagttctcgtgcaca
caagagaagctgccactcggaacatggagaagatacaggtcatcaaggacttcccctgga
tcctggcagatgagcaagatgtccacatgcatgatccccggttga

DBGET integrated database retrieval system