KEGG   Rattus norvegicus (rat): 313742Help
Entry
313742            CDS       T01003                                 

Gene name
Phf13
Definition
(RefSeq) PHD finger protein 13
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PHD PHD_2 NUDE_C zf-HC5HC2H C1_1 FYVE_2 zf-CW
Motif
Other DBs
NCBI-GeneID: 313742
NCBI-ProteinID: NP_001101465
RGD: 1308145
Ensembl: ENSRNOG00000009046
UniProt: D3ZG56
Position
5q36
AA seq 296 aa AA seqDB search
MDSDSCAAAFHPEEYSPTCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANS
TAGTIDSDGWDTGFSDITSSVPDRCFSHLQPSLLQRAKPSDFLLDRKKTDKLKKKRRRKR
RDSDVPGKEEYRGSLLKLEAADPYVEAPSSPTMQDIPQASADPCSGWDSDTPSSGSCATV
SPDQVTEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGR
PMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRMGSRKLFLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggactccgactcctgcgccgccgccttccaccccgaggagtactcccccacttgtaag
aggcgccggactgtggaagacttcaacaagttctgcaccttcgtgctggcctatgcaggc
tacatcccctatccgaaggaggagctccccctgaggagcagccccagtcctgccaacagc
actgcagggaccatcgacagtgatggctgggacactggtttctctgacattacatcttca
gtgcccgaccgatgcttcagccacctgcagccttccctcttgcagagagctaagcccagt
gacttcctgctggacaggaagaaaacggacaagctgaagaagaagaggaggaggaagcgc
agggacagcgacgtgcctgggaaggaggagtacagggggagcctgctgaagctggaagct
gctgacccgtatgtggaggccccctcaagtcccaccatgcaggatattccccaggcctct
gctgacccctgctcgggctgggactctgacactccttcaagtggttcttgtgctactgtg
tcacctgatcaggtcacagaaataaaaactgaagggaaacggactattgtccgccaggga
aagcaggtggtgttccgagacgaagacagcactggtaatgatgaagacatcatggtggac
tcagatgatgattcctgggatcttgtcacctgtttctgcatgaagcccttcgctggtcgc
cccatgatcgagtgtaacgaatgccacacctggatccacctgtcttgtgcgaagatccgc
aagtccaatgttccggaagtgtttgtctgccaaaagtgccgggactccaagtttgatatc
cgtcgctccaaccggtcccgaatgggctcccggaagctgtttctggactga

DBGET integrated database retrieval system