KEGG   Rattus norvegicus (rat): 313782Help
Entry
313782            CDS       T01003                                 

Gene name
Fbxl12
Definition
(RefSeq) F-box and leucine-rich repeat protein 12
  KO
K10278  F-box and leucine-rich repeat protein 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    313782 (Fbxl12)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     313782 (Fbxl12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 313782
NCBI-ProteinID: NP_001020871
RGD: 1305528
Ensembl: ENSRNOG00000020368
UniProt: Q4KM96
Position
8q13
AA seq 273 aa AA seqDB search
MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVAD
LSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPLLECIVLDRVPAFRDEHLQGLT
RFRALRSLVLGGTYRVTETGLDSSLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKI
RLTVGGLSAQGLVFLEGMPVLESLCFQGPLITPEMPTPAQIVSSCLTMPKLRVLEVQGLG
WEGQEAEKVLCKGLPHCLVIVRACPKESMDWWM
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgaaagtcatgtggcacctcctgcgccggtacatggcgtcccggctccactcg
ttgcgcatgggcggctacctattctctggctctcaggccccacagctgtcccctgccttg
atgcgggccctgggccagaaatgccccaacctgaagcgcctgtgcttgcatgtggctgac
ctgagtatggtgcctatcaccagcctgcctagcacactgaggaccctggagctgcacagc
tgcgaaatctcgatgatctggttgcagaaagagcaggaccccacggtgctgccactgctg
gaatgcatcgtgctagaccgagtgccggccttccgtgatgagcaccttcagggccttacc
cgcttccgagccctgcgctcgctggttctgggtggcacctaccgggtcactgagaccggg
ctagattccagcctgcaggagctgagctacctgcaaaggctggaggtgctgggctgcacc
ctgtcagcagacagcaccttgctggccatcagccgccacctccgagatgtgcgcaagatt
cggctgaccgttggaggcctctcagctcagggcctggtgttcctggagggaatgccggtc
ctggagagtttgtgcttccagggtccccttatcaccccagaaatgcccacacccgctcag
attgtgtcctcctgcctcaccatgcctaagctcagagtgcttgaggtgcaggggctgggc
tgggagggccaggaagcagagaaggtcctgtgcaagggcctgccccactgcctagttatc
gtcagagcttgtcccaaagaatccatggactggtggatgtga

DBGET integrated database retrieval system