KEGG   Rattus norvegicus (rat): 313783Help
Entry
313783            CDS       T01003                                 

Gene name
Olfm2
Definition
(RefSeq) olfactomedin 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF Noelin-1 Helo_like_N ABC_tran_CTD PepSY_2
Motif
Other DBs
NCBI-GeneID: 313783
NCBI-ProteinID: NP_001015017
RGD: 1309741
Ensembl: ENSRNOG00000020519
UniProt: Q568Y7
Position
8q13
AA seq 478 aa AA seqDB search
MSVPLLKIGAVLSTMAMVTNWMSQTLPSLVGLNSTVSRAGSSEKITLFQSPEEGWQLYTS
AQAPDGKCICTAVIPAQSTCARDGRSRELRQLMEKVQNVSQSMEVLELRTYRDLQYVRSM
ETLMRSLDARLRTADGSVSAKSFQELKDRMTELLPLSSVLEQYKADTRTIVRLREEVRNL
SGNLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKLTGVSNPITIRAMGSRFGS
WMTDTMAPSADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNG
SLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVY
TTNQNAGNIVVSRLDPHTLEVVRSWDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAY
FTNTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQVLYNVTLFHVISTAGDP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgccgctgctcaagatcggggcggtgctgagcaccatggccatggtcactaac
tggatgtcgcagacgctgccctcgctcgtgggactcaacagcaccgtgtcccgcgcgggc
tcctcagagaaaatcactctcttccagagcccagaagagggctggcagctgtacacgtca
gcgcaggcgccggatggcaaatgcatctgcacagctgtgattcctgcacagagcacctgt
gcccgagatggtcggagcagagagcttcgccagctcatggagaaggtccagaatgtgtct
cagtccatggaagtccttgagctaaggacataccgggatctccagtatgttcgcagcatg
gagaccctcatgcggagcctggatgcaaggctcaggacagccgatgggtcagtctcagcc
aaaagctttcaggaactgaaggacaggatgacagagctgctgcccctgagttcagtgctg
gagcagtacaaagcagacacacggaccattgtgcgcctgcgggaggaggtgaggaacctc
tcaggcaacctggctgccatccaggaggaaatgggtgcctacgggtacgaggacttgcag
cagcgcgtgatggccctggaggcccgactccatgcctgcgcgcagaagctgggctgcggg
aagctgacaggcgtcagtaaccccattaccatccgagccatgggatcccgcttcggctcc
tggatgactgacacgatggcccccagtgcagacagtcgggtctggtacatggatggttat
tacaaaggccgccgagtgctggagttccgtactttgggagacttcatcaaaggccagaac
ttcatccagcacctgctgccgcagccatgggcaggtacgggccatgtggtatacaatgga
tctctgttctacaacaagtaccagagcaatgtggtggttaagtaccacttccggtcccgc
tccgtgttggtgcagaggagcctcccgggggctggttacaataacaccttcccctattcc
tggggcggcttctcggacatggacttcatggtagacgagagcgggctgtgggctgtgtat
accaccaaccagaacgcgggcaacattgtggtcagccggctggaccctcacaccctggag
gtcgtgaggtcctgggacactgggtaccctaagcgcagcgccggtgaggccttcatgatc
tgtggtgtcctctacgtgaccaactctcacctggccggagccaaggtctactttgcgtac
ttcaccaacacgtccagctatgagtacacggatgtgcccttccacaaccagtactcgcac
atctccatgctggattacaaccccagggagcgggccctgtatacctggaacaacgggcac
caggtgctgtacaacgtcaccctcttccacgtcatcagcactgccggggacccctag

DBGET integrated database retrieval system