KEGG   Rattus norvegicus (rat): 313785Help
Entry
313785            CDS       T01003                                 

Gene name
Icam5
Definition
(RefSeq) intercellular adhesion molecule 5
  KO
K06769  intercellular adhesion molecule 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    313785 (Icam5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 I-set ig ICAM_N V-set C2-set_2 Izumo-Ig DUF1515
Motif
Other DBs
NCBI-GeneID: 313785
NCBI-ProteinID: NP_001165550
RGD: 1305039
Ensembl: ENSRNOG00000020694
UniProt: D4A435
Position
8q13
AA seq 917 aa AA seqDB search
MPGPSPGLRRTLLGLWAALGLGILGISAVALEPFWADLQPRVALVERGGSLWLNCSTNCP
RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP
DRVELVPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGGQELIRRSFVGEPPRARGAM
LTATVLARREDHRANFSCLAELDLRPHGLGLFANSSAPRQLRTFAMPPLSPSLIAPRFLE
VGSERPVTCTLDGLFPAPEAGVYLSLGDQRLHPNVTLDGESLVATATATASEEQEGTKQL
MCIVTLGGESRETQENLTVYSFPAPLLTLSEPEAPEGKMVTVSCWAGARALVTLEGIPAA
VPGQPAELQLNVTKNDDKRGFFCDAALDVDGETLRKNQSSELRVLYAPRLDDLDCPRSWT
WPEGPEQTLHCEARGNPEPSVHCARPDGGAVLALGLLGPVTRALAGTYRCTAINGQGQAV
KDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPSVSCVRSGKEEVMEGPLR
VAREHAGTYRCEAINARGSAAKNVAVTVEYGPSFEELGCPSNWTWVEGSGKLFSCEVDGK
PEPRVECVGSEGASEGVVLPLVSSNSGSRNSMTPGNLSPGIYLCNATNRHGSTVKTVVVS
AESPPQMDESSCPSHQTWLEGAEATALACSARGRPSPRVRCSREGAARLERLQVSREDAG
TYLCVATNAHGTDSRTVTVGVEYRPVVAELAASPPSVRPGGNFTLTCRAEAWPPAQISWR
APPGALNLGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAVGG
AAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGTPGAEGGAETPGT
AESPADGEVFAIQLTSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccttcaccagggctgcgccgaacgctcctcggcctctgggctgccctgggc
ctggggatcctaggcatctcagcggtcgcgctagaacctttctgggcggaccttcagccc
cgcgtggcgctcgtggagcgcgggggctcgctgtggctcaactgcagcactaactgtccg
aggccggagcgcggtggcctggagacctcgctacgccgaaacgggacccagaggggtctg
cgctggctggctcgacagctggtggacatccgagagcctgaaacccagccggtctgcttc
ttccgctgcgcgcgccgcacactccaagcgcgtgggctcatccgaactttccagcgaccg
gatcgggtagagctagtgcctctgcctccttggcagcctgtaggtgagaacttcaccttg
agctgcagggtcccgggggcaggaccccgagcgagcctcacattgaccttgctgcgaggc
ggccaggagctgattcgccgaagtttcgtaggcgagccaccccgagctcggggtgcgatg
ctcaccgccacggtcctggcgcgcagagaggatcacagggccaatttctcatgcctcgcg
gagcttgacctgcggccacacggcttgggactgtttgcaaacagctcagcccccagacag
ctccgcacgtttgccatgcctccactttccccgagccttattgccccacgattcttagaa
gtgggctcagaaaggccggtgacttgcactttggatggactgtttcctgccccagaagcc
ggggtttacctctctctgggagatcagaggcttcatcctaatgtgaccctcgacggggag
agccttgtggccactgccacagctacagcaagtgaagaacaggaaggcaccaaacagctg
atgtgcatcgtgaccctcgggggcgaaagcagggagacccaggaaaacctgactgtctac
agcttcccggctcctcttctgactttaagtgagccagaagcccccgagggaaagatggtg
accgtaagctgctgggcaggggcccgagcccttgtcaccttggagggaattccagctgcg
gtccctgggcagcccgctgagctccagttaaatgtcacaaagaatgacgacaagcggggc
ttcttctgcgacgctgccctcgatgtggacggggaaactctgagaaagaaccagagctct
gagcttcgtgttctgtacgcacctcggctggatgacttggactgtcccaggagctggacg
tggccagagggtccagagcagaccctccactgcgaggcccgtggaaaccctgagccctcc
gtgcactgtgcaaggcctgacggtggggcggtgctagcgctgggcctgttgggtccagtg
acccgtgccctcgcgggcacttaccgatgtacagcaatcaatgggcaaggccaggcggtc
aaggatgtgaccctgactgtggaatatgccccagcgctggacagtgtaggctgcccagaa
cgtattacttggctggaggggacagaggcatcgcttagctgtgtggcacacggggtccca
ccacctagcgtgagctgtgtgcgctctggaaaggaggaagtcatggaagggcccctgcgt
gtggcccgggagcacgctggcacttaccgatgcgaagccatcaacgccaggggatcagcg
gccaaaaatgtggctgtcacggtggaatatggtcccagttttgaggagttgggctgcccc
agcaactggacttgggtagaaggatctggaaaactgttttcctgtgaagttgatgggaag
ccggaaccacgcgtggagtgcgtgggctcggagggtgcaagcgaaggggtagtgttgccc
ctggtgtcctcgaactctggttccagaaactctatgactcctggtaacctgtcaccgggt
atttacctctgcaacgccaccaaccggcatggctccacagtcaaaacagtcgtcgtgagc
gcggaatcaccgccacagatggatgaatccagttgcccgagtcaccagacatggctggaa
ggagccgaggctactgcgctggcctgcagtgccagaggccgcccctctccacgcgtgcgc
tgttccagggaaggtgcagccaggctggagaggctacaggtgtcccgagaggatgcgggg
acctacctgtgtgtggctaccaacgcgcatggcacggattcacggaccgtcactgtgggt
gtggaataccggcctgtggtggctgagctggcagcctcgcccccaagcgtgcggcctggc
ggaaacttcactctgacctgccgtgcagaggcctggcctccagcccagatcagctggcgc
gcgcccccgggagctctcaacctcggtctctccagcaacaacagcacgctgagcgtggcg
ggtgccatgggcagccatggtggcgagtatgagtgcgcagccaccaatgcgcatgggcgc
cacgcacggcgcatcacggtgcgcgtggccggtccatggctgtgggtcgctgtgggcggt
gcggcagggggcgcggcgctgctggccgcaggggccggcctggccttctacgtgcagtcc
accgcttgcaagaagggagagtacaacgtccaggaggctgagagctcaggcgaggcggtg
tgtctcaatggcgcgggcgggacaccgggtgcagaaggcggagcagagacccccggcact
gccgagtcacctgcagatggcgaggttttcgccatccagctgacatcttcctga

DBGET integrated database retrieval system