KEGG   Rattus norvegicus (rat): 313811Help
Entry
313811            CDS       T01003                                 

Gene name
Dnajb5
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B5
  KO
K09511  DnaJ homolog subfamily B member 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    313811 (Dnajb5)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   313811 (Dnajb5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ
Motif
Other DBs
NCBI-GeneID: 313811
NCBI-ProteinID: NP_001101474
RGD: 1307453
Ensembl: ENSRNOG00000000130
UniProt: D3ZB76
Position
5q22
AA seq 382 aa AA seqDB search
MFKIQLEPLKLRAWTLNGFVKFRNKEPSTGPVAVMGKDYYKILGIPSGANEDEIKKAYRK
MALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGTSGGSGGSF
HYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGF
NGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRT
EDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSAL
ISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFK
VRFPDRLTPQTRQILKQHLPCS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaattcagctggagcccttaaaacttcgagcgtggacgctgaatgggtttgta
aagtttcgaaacaaggagcccagcaccggtccagtggctgtgatgggaaaagattattac
aagattcttggaatcccgtctggggccaacgaagatgagatcaagaaagcctatcgaaag
atggccttgaagtaccacccagacaagaacaaagaacccaacgctgaggagaagtttaag
gagattgccgaggcctacgacgtgctgagtgaccctaagaaacggagcctgtatgaccag
tatggggaggaaggcctcaagaccggcggtggtacctcaggtggctccggtggctccttt
cactacacctttcacggggaccctcatgccacctttgcttccttctttggtggctccaac
cccttcgatatcttctttgccagcagccgctccactcggcctttcagtggctttgaccca
gatgacatggatgtggatgaagatgaggacccatttggtgcctttggccgctttggcttc
aatgggctgagtaggggtccgaggcgagccccagaaccactgtacccccggcgcaaggta
caggacccccctgtggtgcatgagctgcgggtgtccctggaggagatctaccacggctcc
accaagcgcatgaagatcacaaggcgacgccttaaccccgatgggcgaactgtgcgcacc
gaggacaaaatcctgcacattgtcatcaaacgtggctggaaggagggcaccaagattacc
ttccccaaagagggcgatgccacacccgacaacatcccagccgacattgtcttcgtgctc
aaagacaagcctcatgcgcactttcgccgagatggcaccaacgtgctctacagtgcactc
atcagcctcaaggaggcgctgtgtggctgcaccgtgaacattcccaccattgatggccga
gtgatccctttaccctgcaatgatgttattaaaccaggcaccgtgaagagactccgtggg
gagggacttcccttccccaaggtgcccactcagcggggagacctcattgttgagttcaaa
gttcgattcccagacagattaaccccacagacacggcagatccttaaacagcacctaccc
tgctcctag

DBGET integrated database retrieval system