KEGG   Rattus norvegicus (rat): 313838
Entry
313838            CDS       T01003                                 

Gene name
Cdc42ep3
Definition
(RefSeq) cdc42 effector protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: BORG_CEP PBD
Other DBs
NCBI-GeneID: 313838
NCBI-ProteinID: NP_001041509
RGD: 1305858
Ensembl: ENSRNOG00000032136
UniProt: Q0VGK8
Position
6
AA seq 254 aa
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQ
GNYELLPGNQEKAHSGQFPGHNDFFRANSTSDSMFTETPSPVLKNAISLPTIGGSQALML
PLLSPVTFNSKQESFGRPKLPRLSCEPVMEEKVEEKGSLLENGTVHQGDTSWGSSGSASQ
SSQGRDSHSSSLSEQYSDWPADDMFEHPASCELGKSKTKSEESLSDLTGSLLSLQLDLGP
SLLDEVLNVMDKNK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccagccaagaccccaatttacctgaaagcggctaacaacaagaagggaaagaaattt
aaactgagggacattctgtcccctgatatgatcagtcctcctttgggggactttcgtcac
actattcacatcggcaaagagggccagcatgacgtctttggagacatttcctttcttcaa
gggaactatgagctcttgcctggaaaccaagagaaagcacactccggccagttcccgggg
cacaacgacttcttccgggccaatagcacctcggactcgatgttcacggaaacaccctcc
ccggtgctcaaaaatgccatctccctcccgactattggaggatcccaggctctcatgctg
cccttattatcaccagtgacatttaattccaagcaggagtcctttgggcgtcctaagttg
ccaagactcagctgtgagcctgtcatggaagagaaagttgaggagaaaggtagtctgtta
gagaacgggacagtccaccagggagacacctcgtggggctccagtggttccgcgtctcag
tccagccagggcagggacagccactcctccagcctgtctgaacagtactccgactggccc
gcggacgacatgtttgagcatcctgcctcctgcgagctggggaagtcaaagactaaatca
gaagaatccctttccgacctgaccggctccctgctctccctgcagttggatctggggccc
tcacttttggatgaagtcctgaatgtcatggataaaaataagtaa

DBGET integrated database retrieval system