KEGG   Rattus norvegicus (rat): 313842Help
Entry
313842            CDS       T01003                                 

Gene name
Hnrnpll, Hnrpll, RGD1305861
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein L-like
  KO
K13159  heterogeneous nuclear ribonucleoprotein L
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    313842 (Hnrnpll)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    313842 (Hnrnpll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_5 RRM_1 RRM_8 RL RRM_3
Motif
Other DBs
NCBI-GeneID: 313842
NCBI-ProteinID: XP_001063027
RGD: 1305861
Ensembl: ENSRNOG00000006929
UniProt: D4A3E1
Position
6q11
AA seq 591 aa AA seqDB search
MSSTSSSPKEETYEEDREFESQAKRLKTEEGEIVYSAEESENRQEATPQAGSDSDSGGGD
RGSGGGGGDGEEGDGGEEGDGEEGDEGDGDERGSGGDEGGSGGGPRSMPPSTEGGGSHHK
VSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFA
ADVPVYIAGQQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNP
VGKVQRIVIFKRNGIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIR
NDNDSWDYTKPYLGRRDRGKGRQRQAILGDHPSSFRHDGYGSHGPLLPLPSRYRMGSRDT
PELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTI
PGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFELEDGTSSYKDFA
MSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLPFIKYKVFDAK
ASAKTLSGLLEWKCKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccacctcctcctcccccaaggaggagacgtacgaggaggaccgggagttcgaa
agccaggccaagcgcctcaagacggaggagggagagatcgtctactcggctgaggagagc
gagaatcgccaggaagcgacgcctcaggcggggagcgatagcgacagcggcggcggcgac
cgaggcagcggcggcggcggcggcgacggcgaggaaggcgacggtggagaagaaggcgac
ggcgaagaaggcgacgaaggcgacggcgatgagagaggtagcggcggcgacgaaggcggc
agcggcggcggccctcggagcatgcccccgtccacggagggaggtggaagtcatcataaa
gtttctgtttctcctgttgttcatgttcgagggctctgtgaatccgttgtggaagctgac
cttgtggaggcactggagaaatttgggacaatatgctatgtgatgatgatgccatttaaa
cgacaggctctagtggagtttgaaaatatagatagtgccaaagagtgtgtgacatttgct
gcagatgtgcctgtgtacattgctggccagcaggctttcttcaactactctacaagtaaa
agaatcactcggccaggaaacactgacgatccttcagggggcaacaaagtcctcttgctc
tctattcagaatcctctttatccaattacagtggatgttctatatactgtatgcaaccct
gttggaaaagtacagcgtattgttatattcaagagaaatgggatacaagcaatggttgaa
tttgagtcggtcctttgtgcccagaaagctaaagcagcactcaatggagctgatatatat
gccggatgttgcacactaaaaattgaatatgcaaggccaactcgtctaaatgttattagg
aatgacaatgacagttgggactacactaaaccttatttgggaagacgagatagaggaaag
ggtcgccagaggcaagccattttgggagatcatccttcttcgtttagacatgatggctat
ggatcgcatggtccactattgcctttaccaagtcgttacagaatgggctctagagataca
cctgaacttgttgcttatccattaccacaagcctcttcctcttacatgcatggaggaagc
ccatctggttccgtcgtaatggttagtgggttacatcagctcaaaatgaattgttcaaga
gtcttcaacctattctgcttgtatggaaatattgaaaaggtaaagtttatgaagaccatt
cctggcacagcactcgtagaaatgggtgacgagtatgctgtggaaagagctgtcacacac
cttaacaatgtcaaactgtttgggaaaagacttaatgtttgtgtgtctaaacaacattca
gttgttccaagtcaaatatttgagctagaggatggcacaagcagctacaaagattttgca
atgagcaaaaataatcgctttacaagtgctggccaagcttctaagaatataatccagcca
ccctcatgtgtgctgcattattacaatgttccactgtgtgtcacagaggagaccttcaca
aagttgtgtaatgaccatgaagttcttccattcatcaaatataaagtgtttgatgcaaaa
gcttctgcgaaaactctgtctgggctcttagagtggaaatgcaaaactgatgctgtggaa
gctctgactgcactcaatcactaccagatccgagtcccaaatggttccaacccctataca
ctgaagctttgcttttctacgtcatcccatttataa

DBGET integrated database retrieval system