KEGG   Rattus norvegicus (rat): 313843
Entry
313843            CDS       T01003                                 

Gene name
Galm
Definition
(RefSeq) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno01100  Metabolic pathways
Module
rno_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    313843 (Galm)
   00052 Galactose metabolism
    313843 (Galm)
Enzymes [BR:rno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     313843 (Galm)
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 313843
NCBI-ProteinID: NP_001007705
RGD: 1359459
Ensembl: ENSRNOG00000007023
UniProt: Q66HG4
Position
6q11
AA seq 342 aa
MVSVTRTVFGELPSGGGAVEKFQLRSDQLNVDIISWGCTITALQVKDRQGKASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGRFTVDGKEYHLPINREPNSLHGGFRGFDKVLWTP
QVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPDIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGKHLQSYHIH
GFDHNFCLKESKEKKFCARVHHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKSGEVYPK
HSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKFSVA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtttcggtgaccagaaccgtgtttggagagctgccctcggggggaggggcagtggag
aagttccagcttcggtcagaccagctgaatgtggacatcatctcctggggctgcacgatc
actgctctgcaggtcaaagacaggcaggggaaagcctcagacgtggtgcttggctttgcc
gagttggaaggttacctccagaagcagccctacttcggagcagtggttgggagggtagcc
aaccgaattgccaaaggaaggttcacagtagatgggaaggagtaccacctgcccattaac
agagagcccaacagtctccatggaggattcagaggatttgataaggtcctctggactcct
caggtgctgtccaacggcgtccagttctctcgagtcagtccagatggtgaggaaggctac
cctggagagttgaaagtctgggtgacatataccctggatggcggagagcttgtagtcaac
tacagagcccaggccagccagaccactccagttaatctcaccaaccattcttattttaac
ctagcaggccagggctccccagatatatatgaccacgaagtcaccattgccgcagatgca
tacttgcctgtggatgaaactctgattccaacaggagtcattgctccggtggaaggaact
gctttcgacctgagaaagccagtggagctcgggaaacacctgcagagttaccacatccat
ggtttcgaccataatttctgtctgaaggagtccaaagaaaagaagttttgtgcaagggtg
catcacgctgcaagtgggaggatcctggaagtgtacaccacccaacctggcgtccagttc
tacacaggaaacttcttggatggtaccctgaagggcaagagtggagaggtctatcccaag
cactctggtttctgcctcgagacccagaactggcctgatgcagtcaaccagccccagttc
cctccgatactgctgaggcctggagaggagtacaaccacaccacctggttcaagttctcc
gttgcttaa

DBGET integrated database retrieval system