KEGG   Rattus norvegicus (rat): 313851Help
Entry
313851            CDS       T01003                                 

Gene name
Thumpd2
Definition
(RefSeq) THUMP domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0020 Methyltransf_25 Methyltransf_31 Methyltransf_11 CMAS MTS THUMP Methyltransf_12 Methyltransf_15 Ubie_methyltran AviRa Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 313851
NCBI-ProteinID: NP_001012108
RGD: 1306878
Ensembl: ENSRNOG00000008291
UniProt: A0A0G2K0N2 Q5FVM9
Position
6q11
AA seq 409 aa AA seqDB search
MAAAGADPGSEPAGGAQFFCTAGRGLEPFLMREVRARLEATQVEYISGKVFFTTCSDLPS
MKKLKSAERLFLLIKKQLPITVSSLHRGRLLNEMQRFINDDPGSWLKAISLWRKLLDHDT
NGEKVSQGDANPLKRKAGENDSITPKKLKLEEMQVVDKSHGESQQDQPQGPLEQGETLAR
TDELQEQRLHRASETAAHAQSPEDLTFRISCRCSGSIRKVVTGQEAGRVAGLALMRQFGW
KADLRKPDLEAGALVLDPMCGLGTILVEAAEEWPDVFYVGADVSDSQLLGACDNLKAAGL
AHRIELLKGSVADLPLPAQSVDVIISDIPFGKKFKLGKDIKSILQEMERNPITASIFKNA
HPPSVPVKVAVVEKGDRIPGWRGRPSWLCCRHRQEMPAYRGGSRRSAAR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggggcagacccgggttctgaacccgctggcggcgcccagttcttctgc
accgcgggccgcggcctggagccgttcttgatgcgggaggtgcgcgcgcggctggaggcc
acgcaggttgaatatatttcaggaaaagtgtttttcactacctgttcagatttgccctcg
atgaagaagttaaagtcagcggaaagactgtttttgttgattaagaagcagcttcccatt
acggtctcctccctgcacagaggaagactacttaatgaaatgcaaagatttataaacgat
gacccaggaagctggctgaaggcgatttcactctggagaaaacttctcgaccatgataca
aatggagaaaaggtttctcaaggggatgctaacccactaaaacggaaagcaggagaaaat
gacagtatcactcctaagaaattgaaattagaggagatgcaagtggttgacaagagtcac
ggggaaagccagcaggaccaaccacaaggcccactggagcaaggggaaactctcgctaga
acggacgagctccaagagcaaagactccacagagcctcggagacggcggcgcatgctcag
agcccggaggacttgaccttcaggatttcctgtcgctgcagcgggagtatcagaaaggtt
gtcaccggacaggaggcaggaagagtggctggactggctctcatgaggcagtttggttgg
aaagctgatttgaggaagccagacttagaggcaggagccctggttttagatccaatgtgt
ggccttgggactatacttgtggaagctgctgaagagtggccagacgtattttacgtgggt
gctgatgtgagcgactcgcagttacttggcgcatgtgacaatctgaaggccgcaggcctt
gcacacaggatcgagttactcaaaggctctgtcgcagatttaccactgccagctcaaagt
gtggacgttattatttctgacattccatttggaaaaaaatttaagttgggaaaagacatc
aaaagcattctacaagaaatggaaagaaatcctataacagcctccatcttcaaaaatgct
caccctcccagtgttcctgtcaaggtggccgttgtggagaaaggggacagaatacccggc
tggagagggagaccatcctggctgtgctgtaggcatcgtcaagagatgcctgcctacaga
ggtggcagcagaaggagtgctgcacgttga

DBGET integrated database retrieval system