KEGG   Rattus norvegicus (rat): 313874
Entry
313874            CDS       T01003                                 

Gene name
Rasgrp3
Definition
(RefSeq) ras guanyl-releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04662  B cell receptor signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    313874 (Rasgrp3)
   04014 Ras signaling pathway
    313874 (Rasgrp3)
   04015 Rap1 signaling pathway
    313874 (Rasgrp3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    313874 (Rasgrp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    313874 (Rasgrp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    313874 (Rasgrp3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   313874 (Rasgrp3)
SSDB
Motif
Pfam: RasGEF C1_1 RasGEF_N
Other DBs
NCBI-GeneID: 313874
NCBI-ProteinID: NP_001101479
RGD: 1304612
Ensembl: ENSRNOG00000032703
UniProt: D3ZZN2
Position
6
AA seq 603 aa
MGSNGLGKAATLDELLSTCIEMFDDNGELNDSYLPRIMLLMHRWYLSSTELAGKLLCMYR
NASGESCDEFRLKICYFMRYWITKFPAEFNLDLGLIRMTEEFREVASQLGYEKHSNLMDI
SSIPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNT
LMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKH
IRKLVELWGIIKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPESLPGSPALPP
VQDEVFEFPGVTARHRDLDSRDITLVTGSSRKISVRVQRATTSQATQTEPVWSEAVWGDS
GSHTFPKMKSKLHDKAAKDKGFAKWENEKPTLHAGVDVVDRGTAFEPDQDDEQDEAQQGV
EDG
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggggtccaacggcctcgggaaagcggcgacactagatgaacttctcagcacatgcatt
gagatgtttgatgacaatggagaactgaatgacagctacttgcccagaatcatgctactg
atgcatcgatggtatttatcctccactgaactggcaggaaaactcctatgcatgtatcgg
aatgccagcggagaaagttgtgatgagttccgactgaagatctgctatttcatgaggtac
tggattacaaaatttcctgcagagtttaatttggatcttggtttgattcgcatgactgag
gagttccgggaagtagctagtcaactaggatatgagaaacacagcaacctcatggacata
tccagcattccttcctatgactggatgaggagagtcacgcagaggaaaaaagtatcaaaa
aggggaaaggcctgtctcttatttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcgttcacagattatcagagctacgtc
attcatggctgcctggagaataacccgacattggagagatctattgccttatttaatgga
atctctaagtgggtccaattgatggttcttagcaaaccaagtgctcaacaaagggcggaa
gtcatcacaaagttcatcaatgtagcacagaaactccttcaactaaaaaattttaacacc
ttgatggctgtggttggtggccttagtcacagctccatttcccgactcaaagatacccat
tctcacctctcttctgaagttacaaagaactggaatgagatgacagagttggtctcctcc
aacggcaattactgcaattaccgcaaggcctttgctgactgtgatggcttcaaaatcccc
atccttggcgtgcacttgaaagacttgatagcagtccatgtcattttcccagactggatg
gaagagaacaaagtgaacgttgtgaaaatgcaccagctttctgttaccctgagtgaactg
gtctccctgcagaatgcctctcaccacttggagcctaacatggatttgatcaacctcctc
actctctctctggacctctaccacacagaagacgatatttataaactatcactggtgctg
gagcctaggaattccaaatcacagccaacttcccccacaacacctaataagcctgtggta
cccctggagtgggcttcagaagtggtaccaaagccagaccccacaatcatcaacaaacac
ataaggaagttggttgagctctggggcataatcaaacaaggctacaaatgcaaagactgt
ggagccaactgtcacaaacagtgcaaagacctcttggttctggcctgtaggagacttgcc
agggcaccctccttgagcagcaaccctgagtcactgcctggaagcccagccttgccccca
gtgcaggatgaggtgtttgagtttcctggcgtcactgctagacaccgagacctggacagc
agagacatcacgctggttacaggatcttcccgtaagatctccgtgagagtgcagagagcc
accactagtcaagccacgcaaaccgaacctgtgtggtcagaggctgtctggggagactct
gggtcccataccttccccaaaatgaaatccaagctccatgacaaagcagcaaaggacaaa
ggctttgccaagtgggaaaatgaaaagcccacgctacacgctggtgtggatgttgtagat
cgaggcactgcattcgaacctgaccaggacgatgagcaagatgaagcccaacagggtgtc
gaggatggctga

DBGET integrated database retrieval system