KEGG   Rattus norvegicus (rat): 313891Help
Entry
313891            CDS       T01003                                 

Gene name
RGD1304963
Definition
(RefSeq) similar to hypothetical protein MGC38716
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Retinal
Motif
Other DBs
NCBI-GeneID: 313891
NCBI-ProteinID: XP_006225764
RGD: 1304963
Ensembl: ENSRNOG00000008942
UniProt: D3ZS67
Position
6q13
AA seq 1271 aa AA seqDB search
MGCTPSHNVIVNSVAKSGIQFFKRPKAILPGCQWGSQKCPIPLLIQSSTFCDPGGELHPG
ARLAEETASSRKLPDMTEGLCQLPESQTFHMNKSQSRMATDISFRTEGSHRTQEVEFSGK
EGKENTPRETSERGREPKCHPSDSQDHCCQTVPEPKGKVDFPESLVKAHQHAYAYLHTSL
SRYEAIVHLVQQASQTWELLQSMLSFLLLGFEEASQLLGEISKDGEVLLREVRGDLAWPV
RKGEPWEHPDLLQQLLQYTVNKLQVVHSTVAALTGSFLEGSSSYLRATAGHLEGKLSTKR
GIDECLLRALGQLESLTSGSSDPGLLGPPLCSEDSGIGADNESVHSVEKLGKQASWDFAA
ELGEWKPGTAAQGEARPSGHAWQKGPYWTGPDRPQDCPLSGPRIAKVQPAVQDEARSSNT
SSTSPEAVTSRPPEAAKSIPWDSLGTEIPVQTQLSRRSSGLMGSPYLSGDEDSSPEEEDE
LGSTDLHPEPQKALPSRPQSSPDPRESLFQPYSTKLRSPQAQEMILKMKEAISERIKFVP
VPSRPQDWAEEEEGRSVVPPRPRSVSGCRRAPERQRRSQSEGCLKSHVEDPTLQELRRVQ
TDLSKRLEVFYALGATQQGQSREQCLPPRTSLLWPPTNCRVSPSSAISKFKASLTQNFSI
LPNQDKSIFQRGSPCFDSDQPCQGKAEKLPSAIFCGKKNSRAPGDNERDIRACPTRTSVK
KLIETFSPTESPRMPRDCRNLGTSPCLRKWGVPAMPPRFPIYRGLAPLYPKPQISPAVGR
DPLKLGMSWRPSAPFPSLPPAEASEGEDIGGEMEEDLQNLPPPPLEILMDKSFTALEHPE
CSLEETLLPELQEARRPKRTWASPKLKASMSPMDLLPSKGNGSSPRLQGTRPGSTSNVGN
SRKLTLDLNSQQTANPSPEAEGGAQIQAPPENTAGLSKHHQKAIPRHHANPTSGQSRALE
PSLARFSRDPHSPEASRKGPERSPPGVRKASPPRAQWASQGGRRLQSLPSTHGPSQPGLR
AVLSSPSPPLSPRTLSPPATRKPTSPPCQYPQSNPAPGSPPVQRTETNTPSSASSSSPSV
SPSRGSKDSSHSEDSEGTTNKASRGTCSVLFPATAFCEAKSSFSTSHPQTLPEPGGLLRT
PAGGWRGSAGPRLRADSQKRTVLNALDALPFVRRTASDRQRQQGDPLQLPSSDWESHPCQ
NSSSSSSEENAKQELPPWNNSRVPELQSSSTKWTSPLELCVLGHGLQPEARPSRSQDRSQ
PESQPQHKEVS
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcacaccgtcacacaatgtcatcgtcaacagcgtcgccaagagtggcattcag
ttctttaagaggcctaaagcgattttgccaggatgtcagtggggcagccaaaaatgcccc
atccctttgctaattcaaagttccaccttctgtgaccctggtggggagctgcacccggga
gcgaggctggcagaggagacagcaagttccaggaagctcccggacatgactgaaggtctt
tgtcagctcccagaaagccaaaccttccacatgaacaaatcacaaagccgcatggctaca
gacatttcgttcaggacagaaggctcccacaggacacaagaagtagagttttctgggaaa
gagggtaaggaaaacactccccgggagacctcagagcggggcagagagccaaagtgccat
ccatcagacagccaggaccattgctgccaaacagttcctgagccaaaaggcaaagtggac
ttccctgagtccctggtaaaggcccaccagcatgcttacgcctacctgcacaccagcctt
tccagatatgaagcaattgtgcacctcgtccagcaagccagccagacctgggagctcttg
cagtccatgcttagcttcctgctgctgggcttcgaggaggccagccagcttctgggagaa
atctctaaagatggagaggtgctcctccgggaagttagaggggatctggcatggccggtg
aggaagggtgagccctgggaacacccagacctccttcaacagctgctgcagtatacagtc
aacaagctgcaggtggtgcacagcacagtggccgccctcacggggagcttcctggaaggc
tccagcagctacctcagagccactgccggccacctcgaaggtaagctgagtaccaagaga
ggtatagatgaatgtctcctgagggccctgggacagctagagagtctgaccagtggctcc
agtgacccggggctgctgggtccacccttatgctctgaggacagtggcatcggtgctgac
aatgagtctgtgcactccgtggagaagctgggcaagcaagccagctgggactttgcagca
gaacttggagaatggaagccagggactgcagcccaaggggaggccaggccgtcagggcat
gcctggcagaaaggtccatactggacaggtccagacagaccccaggactgtccactgtca
ggccccaggatagcaaaggttcaacctgcagtgcaggatgaagcccggagttcgaacact
tccagcactagcccagaagcagtcacctccaggcctccagaggctgccaaaagcatcccg
tgggactctctggggaccgagatccctgtgcagacacagctttctcgacgaagctcagga
ctgatgggttctccgtacctgagtggagatgaggacagcagcccagaggaggaagatgaa
cttggcagcacggatctgcatcctgagccacagaaagcccttccttcaagaccacagtcc
tcaccagacccccgggagagcctgtttcagccatactccacgaagcttaggagcccccag
gcccaggaaatgattctgaagatgaaagaggccatcagtgaaaggatcaagtttgtcccc
gtgccttccagaccccaggactgggctgaggaggaggaagggaggtcagtggtccctccg
agacccagatctgtcagtggctgcaggagggcccctgagagacaaaggaggtcgcaatca
gagggatgcctcaagagccatgtggaagaccccaccctccaggagctgaggagggtccag
acagacctcagtaagaggctggaggtattttatgctctgggtgccacacagcagggacag
agcagggagcaatgtctgccacccaggacatcactgctatggcctcccaccaactgcagg
gtgagtcccagtagtgccatcagcaagttcaaggcctctctcacccaaaacttcagcatt
ttgcccaaccaggacaagagcatcttccaaagaggtagtccctgctttgacagtgaccag
ccttgccaggggaaggctgaaaagctgccaagtgccatcttttgtggcaagaagaacagt
agggctcccggagacaatgaaagggacatcagggcctgtcccaccagaacatcagtcaag
aagcttattgaaactttcagtcctaccgagagtccgaggatgccaagggactgcaggaac
ttggggacaagcccctgcctcaggaagtggggtgttcctgccatgcctcccagatttcct
atatacagggggctagcccccctgtatcctaagccccagatttctccagcagtaggcaga
gaccctctcaagctgggcatgagctggaggccttctgcaccctttccctcccttcctcca
gcggaagcatctgagggtgaagacataggcggtgaaatggaggaagacctgcagaacctc
cctccaccacctctggaaatcctgatggacaaatcgttcactgctctggaacatccagaa
tgtagcctggaggagaccctgttaccagagcttcaggaggccagacgtccaaaaagaaca
tgggcttcccccaagctgaaagcctccatgagccccatggacttgctccccagcaagggc
aatggcagctccccgaggctacagggcaccaggcccgggagcaccagtaatgtgggcaat
tccagaaagttgaccttggaccttaactctcagcaaacagctaacccaagcccagaggcg
gagggtggagctcagattcaggcacccccagagaatacggcaggcctctccaagcatcac
caaaaggcaattcccaggcatcacgctaaccctacatctgggcaaagcagggccttggag
cccagcctagccagattttcacgagatccacactctccagaagcgtccaggaagggtcca
gagagaagccctccaggagtcagaaaggcctctcccccaagagctcagtgggcatcccaa
ggaggcaggaggctgcagagcctgccctccactcatggaccgtcccagccgggcctccgt
gctgtcctcagctcccccagcccacccctgagccccaggacactgagcccaccggccaca
agaaaaccaacttccccaccatgccagtacccgcagtccaacccagccccagggagccct
cctgtccaaaggacagaaacaaacaccccctcctctgcttcctcttcatccccctcagtg
tctccatctcgagggtccaaggactcaagtcactctgaggacagcgaaggtaccacaaac
aaagcatccaggggcacatgttccgtactcttcccggccacagctttctgtgaagctaaa
tcgtcattctcaacatcccatccacagacgctaccagaacctgggggccttctgaggacc
ccagcaggaggctggaggggcagcgcagggccacgactgagggcagattcacagaagaga
acagttctgaacgccctcgacgccctgccttttgtcagaaggacagcttccgaccgccag
cgccagcagggcgacccacttcagctgcccagctcagactgggaatcccatccctgccaa
aacagcagcagcagtagcagtgaggagaacgccaagcaagaactcccaccttggaacaac
tcccgagtcccagaattgcagagtagtagcaccaagtggacctctcctttggagctctgt
gtgctgggccatgggttgcagccagaagcccggccgagccgtagccaggacagatcccag
ccagagtcacagccccagcacaaggaagtttcgtga

DBGET integrated database retrieval system