KEGG   Rattus norvegicus (rat): 313913Help
Entry
313913            CDS       T01003                                 

Gene name
Zfp513, Znf513
Definition
(RefSeq) zinc finger protein 513
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2H2_4 OrsD GAGA
Motif
Other DBs
NCBI-GeneID: 313913
NCBI-ProteinID: NP_001012110
RGD: 1310456
Ensembl: ENSRNOG00000005298
UniProt: Q5FWU5
Position
6q14
AA seq 541 aa AA seqDB search
MPRRKQSHPQPVKCEGVKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEEEGDGHND
QLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPAC
QLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRC
GRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCG
FRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGTSFLPDCGQLRGEGEGLC
GTGSEPLPELLFPWTCRGCGQELEEGEGSRLGTAMCGRCMRGESGGGGSGGPQGPSDKGF
ACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPL
CPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYT
TGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGSAALGATGSRALHTDS
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaaggaagcaaagccatccacagcccgtgaaatgcgagggggtcaaagtggat
actgaagattccttcgacgaaggacctggggctctggtgttggagagtgatttgctacta
ggccaagatctggagttcgaagaggaagaggaagaggaggaaggtgacggccacaacgac
cagctcatgggctttgagagagactctgaaggagactctcagggagccagacctggactt
ccctatgggctgagtgacgatgagtctgggggcggccgggcactaagtgcggaaagtgaa
gttgaggagccagcgaggggtccaggggaggccaggggtgagaggccaggcccagcctgt
cagctgtgtggggggccgacaggtgaggggccgtgttgtggggcaggagggccgggtggg
gggcccccgctgcccccacggctactgtactcatgccgcctctgcgccttcgtgtcccac
tactcgagccacctgaagcggcacatgcagacacacagcggggagaagccgttccgctgt
ggccgctgcccctacgcctcagcccagctcgtcaacctgacgcgacatacccgcacccat
actggcgagaagccctaccgctgtccccactgcccctttgcctgcagcagcctgggcaac
ctgaggcggcatcagcgcacccacacagggcctcccactcctccctgcccaacctgtggt
ttccgatgctgtgctccacgaccaacccggcctcccagtcccacagagcaggaagggaca
atgccccggcgatcagaagatgctctcatcctcccagacctgagtctccatgtgccacca
ggtggtaccagtttcctgccagattgtgggcagctgcggggtgaaggggagggtttgtgt
ggaactggatcagaaccactgccagagctactgttcccttggacctgccggggctgtgga
caagaactggaggagggtgagggcagcaggttgggaactgccatgtgtgggcgctgcatg
cgaggagagtctggagggggtggcagtggggggccccagggccctagtgacaaaggcttt
gcctgtagtctatgcccctttgctactcactaccccaaccacctggcccggcacatgaag
acccacagtggtgagaagcccttccgctgtgcccgctgtccatacgcctctgcgcatctg
gataacctgaaacgccaccagcgcgtccacacaggagaaaagccctacaagtgccctctc
tgtccgtatgcctgtggcaacctggccaacctcaagcgtcacggtcgtatccactctggt
gacaaaccttttcggtgtagcctttgcaactacagctgcaaccagagcatgaacctcaaa
cgtcatatgctgcgacacacgggcgagaagcccttccgctgtgccacctgtgcttacacc
acaggccactgggacaactacaagcgtcatcagaaggtgcatggccatggtggagcagga
gggcctggtctctctgcccctgagggttgggccccacctcatagcccaccctctgtcttg
agcactcggggttcagccgccctgggtgctactggtagcagggctcttcacacagactca
ccttga

DBGET integrated database retrieval system