KEGG   Rattus norvegicus (rat): 313917
Entry
313917            CDS       T01003                                 

Gene name
Abhd1
Definition
(RefSeq) abhydrolase domain containing 1
  KO
K13696  abhydrolase domain-containing protein 1/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    313917 (Abhd1)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 DUF915 Peptidase_S9 Esterase
Other DBs
NCBI-GeneID: 313917
NCBI-ProteinID: NP_001008520
RGD: 1310988
Ensembl: ENSRNOG00000025689
UniProt: Q5RK23
Position
6q14
AA seq 412 aa
MEYLHITKMLSSSLSPQNGTWSDAISLLLALGIALYLGYYWACVPQRPRLVAGPQFLAFL
EQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVIPYRSEVLQTPDGGQFLLDWAEQPY
SSHCPDPTTQPIVLLLPGISGSSQEPYILHLVDQALKDGYRAVVFNNRGCRGEELLTHRA
YCASNTEDLETVVKHIKHRYSRAPLLAVGISFGGILVLNYLARTGKAGGLVAGLTMSACW
DSFETVDSLETPLNSLLFNQPLTAGLCRLVARNRKSIEKVLDVDFAIKARTIRQLDERYT
SVAFGYKDCAAYYHASSPRTKVDAICTPVLCLNAADDPFSPVQALPLQAAQKSPYVALLI
TARGGHIGFLEGLLPWQHCYMNRVLHQYARAVFQHSVGLPGLGALTPEDGKS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggaatacctccacataaccaagatgctgagttcctctctgagcccgcaaaatggcacc
tggtcagatgccatctctctgctcttagctcttggcattgctctctacttgggctactac
tgggcatgtgtgccccagaggcctcgtctggtggctgggccccagtttctggccttcctg
gagcaacactgtccagtcactgtggagactttctaccccacactatggtgctttgaggga
cggctgcaaaccatctttcgagtcctcctgcagtctcagcctgtgatcccttaccggagt
gaagtcctccagaccccggatggaggccagttccttctggactgggctgagcagccttac
agcagtcactgcccagacccgaccacccagcccatagtactattgcttccgggtatcagc
ggcagcagccaggagccatatatcttacacctagttgaccaggctctgaaggatggctat
agggctgttgtatttaataaccgtggatgccgaggggaagagctgctgacgcacagggct
tactgtgccagcaacactgaagacctagaaacggttgtgaagcacataaagcaccgctac
tcccgagctccactgctggctgtggggatctctttcggagggatactggtacttaactac
ctggcacggaccgggaaggctggaggcttggtcgcgggactgaccatgtctgcgtgttgg
gattcctttgagaccgttgactccttggagaccccactcaactcactgctcttcaaccag
cccctcactgctggactctgccggcttgtggccaggaacagaaagtcaattgaaaaggtg
ttggatgtagactttgcgataaaggcccgcacaatccgccagctggatgagcgctacaca
tctgtggcttttgggtataaagactgtgcggcttattaccatgcctcaagcccgagaacc
aaggtggatgccatctgcacccctgtcctctgcctcaatgcagcagacgatcccttctcc
ccagtgcaggccctccctctgcaggctgcccagaagtctccctacgtggccctgctcatc
acagctcggggtggccacattggcttcctggaagggctgctgccctggcaacactgttac
atgaaccgcgtgctacatcagtatgcccgagctgtcttccagcactcggtggggctgccg
ggcctcggagcactcactcctgaagatggaaagagctga

DBGET integrated database retrieval system