KEGG   Rattus norvegicus (rat): 313936Help
Entry
313936            CDS       T01003                                 

Gene name
Fam228a
Definition
(RefSeq) family with sequence similarity 228, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 313936
NCBI-ProteinID: NP_001014096
RGD: 1359275
Ensembl: ENSRNOG00000050114
UniProt: Q5XIN5
Position
6q14
AA seq 277 aa AA seqDB search
MKELAREDIDEAVHAILFRENYIVKKLDTYLQHEAVFKERRKEMLHKKWVENVAQPLQQR
IIEKLFSYRRPGKSQVKYEYCLKHTNEPTKPSPLCECLFQKQQALREAKGPSYHRGRGKQ
PGIQKEAKETEKGLLFTRSPQFPLRSHCTVPRDRQRLHARFVQNKPCGRNKYKGAGSEKV
SYALKPHLPKEEKKTVNRSQLGFERQFHASKLSQQNKGAEKKGLALGTRAQRPRSWAAAD
SPQGTPLVGRRVMTAEILGKHLASLQQASRAVYSNSP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaattagctagagaagacatcgacgaagctgtgcatgcaatcttgtttagggaa
aactacattgtgaagaagttggatacatatttacagcacgaggctgtctttaaggaaaga
aggaaagagatgctgcataagaaatgggttgaaaatgtggcacagccccttcagcagaga
atcatagaaaaattattttcatatagaagacctggaaaaagtcaagtgaaatacgaatac
tgcttaaagcacacaaatgaaccgaccaaaccatctccattgtgtgaatgtctgtttcaa
aaacagcaagcgctcagagaagcaaagggacccagttaccaccgtggcagaggaaaacag
cctggcatacaaaaagaagccaaagaaactgagaagggtctcctcttcaccagatcaccc
cagttcccgctcaggtcccattgcaccgttcccagagacaggcagagacttcatgcacga
ttcgtgcagaataagccttgtggcagaaacaagtacaagggagccggttctgaaaaggtg
agctatgcgttaaagccccatctgcctaaggaggagaagaagactgttaatcgaagccag
cttggttttgaaaggcagttccatgcctcaaagctcagccagcagaacaaaggggctgaa
aagaagggcctggctttagggacccgagcacagagaccacgctcctgggcggcagcagac
agtccgcaggggacaccacttgtgggaagaagagtgatgacagctgagatcctggggaag
catctggcctccttgcagcaggcatccagggctgtctacagcaactcgccctga

DBGET integrated database retrieval system