KEGG   Rattus norvegicus (rat): 314013Help
Entry
314013            CDS       T01003                                 

Gene name
Trappc12, RGD1566054, Ttc15
Definition
(RefSeq) trafficking protein particle complex 12
  KO
K20309  trafficking protein particle complex subunit 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314013 (Trappc12)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    314013 (Trappc12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_19 TPR_16 TPR_8 TPR_17 TPR_6 Coatomer_E TPR_9 TPR_15 TPR_MalT
Motif
Other DBs
NCBI-GeneID: 314013
NCBI-ProteinID: XP_001071807
RGD: 1566054
Ensembl: ENSRNOG00000009039
UniProt: D3ZE49
Position
6q16
AA seq 797 aa AA seqDB search
METAKDGEQSPSEASPPTQAGPETISEPVPLEEEGQPLYHEETIDLGGDDFASEETEPTS
EGSHNFGDKLNEHMMESVLISDSPNNSEGDVGDLGCLQDVGEPPRGATDHRLPDSTDKEV
VDTLSNGSETDGDDTPRDISDMTPDSRASLKEDSTQEDVPAMPALENAGTEEVGPKDSLV
PREEQTSEVSSSQSSSKDEPLPVCTIFSQATSTSSQPHLFLQDGFESQMVKSPSFSSTSE
TSAKTPPPMVQPSPSLSTFFGDTMSSNSLASDFFDSFTTSTFISVSNPNAGSPVPEKLAS
LTAPVGEKSPDSTSPSYSTRMDRSESGVSRAALDVPESPKPFSQIQAVFAGSDDPFATAL
SMSEMDRRNDAWLPSQATREVLMSVATQQYGTVFIDKENLTMPGLKFDNIQGDAVKDLML
RFLGEKAAAKRQVLNASSVEQSFVGLKQLISCRNWRAAVDLCGRLLTAHGQGYGKSGLPT
NHTTDSLQLWFVRLALLVKLGLFQNAEMEFEPFGNLDQPDLYYEYYPHVYPGRRGSMVPF
SMRILHAELQQYLGNPQESLDRLHRVKTVCSKILANLEQGLAEDGGLSSVTQESRQASVQ
LWRSRLGRVLYSMANCLLLMKDYVLAVNAYLTVIKYYPEQEPQLLSGIGRILLQIGDIKT
AEKYFQDVEKVTQKLDGLQGKIMVLMNRAFLYLGQNNFAEAHKFFTEILRMDPTNAVANN
NAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQSLLEA
VASKEGDSFNTQCLKLA
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagctaaggatggtgagcagagcccaagtgaggcatctcctccaacccaggcc
ggtcctgaaaccatctcagagcctgtgcctctggaggaggagggtcagccgctgtaccat
gaggagaccattgatctcggtggagatgactttgcgtctgaagagacggagcccacatcc
gaaggttctcacaacttcggagataagcttaatgaacacatgatggagagcgtgctcatc
tctgactctccgaacaacagcgagggtgatgtgggcgacctcggctgtctgcaggatgtc
ggggagccgcccagaggtgccaccgaccacagactgcccgatagcacggacaaagaagtg
gtggacaccctgagtaatggcagtgagaccgatggagacgatactcccagagacatctca
gacatgacccctgatagcagagcctccctgaaggaagactcaacccaggaagatgtgccg
gccatgcctgcactggagaatgctggcacggaggaagtggggcctaaagacagccttgtg
ccccgagaagagcagacctcagaagtgtcctccagtcagtcctcctccaaagacgagccc
ttgcctgtctgcaccatcttcagccaggccacctccacttcctcccagccacacttgttt
ctacaagatggcttcgagtcccagatggtgaaatcgcccagtttcagtagcaccagcgag
acatcagccaagacccctcctcccatggtccagcccagtcccagcctgagtacatttttc
ggagatacaatgagctctaattccttggcctctgatttctttgattccttcacaacttct
actttcatttcggtcagtaatcccaacgctggttccccggtcccagaaaagctggcttca
ctcactgcccctgtaggggaaaagtcacccgattccaccagcccatcttactctacaagg
atggatagatcggaatctggtgtctctcgggccgctctggatgtccctgaatctccaaag
ccattctcacagatccaggctgtgtttgctgggagcgatgaccccttcgccacagccctg
agcatgagcgagatggaccggaggaatgacgcatggcttcccagtcaggcaaccagagaa
gtcctgatgtcagtagcaacccagcagtatggcaccgtgttcatagacaaggagaacctc
actatgcccggcctcaagtttgacaacattcagggagatgcagttaaagacttgatgctt
cgcttcctgggtgagaaggctgcagcaaagaggcaagtcttaaatgccagctcggtggaa
cagtcctttgtggggctgaagcagctcatcagctgcaggaactggagggcggcagtcgac
ctgtgtggacgcctgctcacagcccacggacaaggctatggcaagagtgggctgcctacc
aaccacaccacagactccttgcagctctggtttgtgaggctggcgctgctggtgaagttg
ggccttttccagaatgccgagatggaatttgaaccctttggaaatctggatcagccagac
ctctattatgaatactacccacacgtgtacccaggacgcaggggctccatggtccccttt
tcgatgcgtattctgcatgcagaactgcagcagtatctggggaacccacaggagtccctg
gaccgattacacagggtcaagaccgtctgcagcaagatcctggccaacttggagcaaggc
ttagctgaagacggtggtctgagcagtgtcacccaggaaagcaggcaagcctctgttcag
ctgtggaggtctcgtctgggccgagtgctgtactccatggcaaactgtctgctcctgatg
aaggactatgtgctggctgtaaacgcttacctcacagtaatcaagtactacccggagcag
gagccacagctgctgagtggaattggccgcattctcctccagattggagacataaaaaca
gctgaaaaatattttcaagacgttgagaaagtaactcagaagttggatggactacagggt
aaaataatggttttaatgaacagagcctttctgtaccttggccagaataactttgcagaa
gctcacaagttcttcacagagattttgaggatggacccgacaaatgcagtggccaacaac
aatgctgctgtgtgtctgctttacctggggaagctcaaggactccctgcggcagctggag
gccatggtgcagcaggaccccaggcactacctgcacgagagcgtgctcttcaacctgacc
accatgtatgagctggagtcctcaaggagcatgcagaagaagcagagcctacttgaggcc
gttgccagcaaagaaggggacagcttcaacacgcagtgcctgaagctggcctag

DBGET integrated database retrieval system