KEGG   Rattus norvegicus (rat): 314213Help
Entry
314213            CDS       T01003                                 

Gene name
Gpr135
Definition
(RefSeq) G protein-coupled receptor 135
  KO
K08427  G protein-coupled receptor 135
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    314213 (Gpr135)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    314213 (Gpr135)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 314213
NCBI-ProteinID: NP_861436
RGD: 727844
Ensembl: ENSRNOG00000004499
UniProt: Q7TQN7
Position
6q24
AA seq 457 aa AA seqDB search
MEEQARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR
GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL
TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP
RDKLGRRRALQLLAGAWLAALGFSLPWELLRAPREPPTPQSFHRCLYRTSPDPAQLGAAY
SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI
VFVICCWGPYCFLVLLAATRQGQTTQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISMF
LGRNREEGYRTRNMDVFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV
VMWARKNPVVLFFREDPPDPVMAVYKQHKSETRDSSI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcaggcgcggccgccgagccgcccggctgcgagtgcaaccttgccgggtagc
gcacatcccggaggggcggcttccacggccaccgcggccgcgctgtcgttcagctccgta
gccaccgtaacgctgggaaaccagagcgatgcgggcaggccggaggcggctgggtctcgg
ggaccggcaccgctgctttggcacggggcagcagtggccgcccaggcgctcgtgctcctg
ctcatcttcttactgtctagcctgggaaactgcgcggtgatgggggtgatcgtgaagcac
cggcagctgcgcacggtcaccaacgccttcatcctatcgctgtccctgtcggacctgctc
actgcgctgctctgcttacccgccgccttcctcgacctgtttgcgccgccgggagactcg
gggccctggcgcagcttctgcgccgccagccgcttcttcagttcgtgtttcggcatcgtc
tccacgttcagcgtggcgctcatctcgctggaccgctactgcgccatcgtgcggccgccg
cgggacaagctaggccggcggcgcgcgctgcagctgctggccggagcgtggctggctgcg
ctcggcttctccctgccctgggagctgctccgggcaccccgggagcccccgactccgcag
agcttccaccgctgcctttacagaacctccccagaccctgcgcagctgggcgccgcttac
agcgtggggctggtggtggcttgctacctgctgcccttcctgctgatgtgtttctgccgc
taccacatctgcaagactgtgcgcctgtcggacgtgcgtgtgcggccgatgaccacctat
gcgcgcgtgctgcgctttttcagcgaggtgcgcacggccaccaccgtgctcatcatgatt
gtctttgtcatctgctgctggggcccctactgcttcctggtgttgttggctgctacccgg
cagggtcagaccacacaggctccctcgctgctcaatgtggcagctgtttggctgacctgg
gccaatggagctatcaacccggtcatatatgccatccgcaaccctaacatttctatgttc
ctaggtcgcaaccgcgaagagggatataggactagaaacatggatgtttttttgcctagc
caaggcctaggttttcaggccagaagtcgcaatcgccttcgaaatggctgtgccaacagg
cttggggcttgcagcaggatgccttcttccaaccccgctagtgggtcaggaggggaagtg
gtcatgtgggctcgaaaaaacccagttgtgctcttcttccgagaggatccaccagaccca
gttatggcagtctacaaacagcataaatctgaaaccagggacagtagcatctaa

DBGET integrated database retrieval system