KEGG   Rattus norvegicus (rat): 314224Help
Entry
314224            CDS       T01003                                 

Gene name
Tmem30b
Definition
(RefSeq) transmembrane protein 30B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CDC50
Motif
Other DBs
NCBI-GeneID: 314224
NCBI-ProteinID: NP_001073849
RGD: 1308732
Ensembl: ENSRNOG00000008046
UniProt: D3Z9E9
Position
6q24
AA seq 353 aa AA seqDB search
MTWSASARGAQQPDNTAFTQQRLPAWQPLLSAGITLPLFFCAGLAFIGLGLGLFYSSNGI
QELEYDYTGNPGTGNCSVCAAKGQDRAPPPSCQCSWSFTLPELFPGPVYLYYELSNFYQN
NRRYGVSRDDAQLSGLASALRHPANECAPYQFSSDGLPIAPCGAIANSLFNDSFSLWHQR
QPADPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFKGTAPPPNWHRPVYELSPDP
NNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHK
LIILSNISWMGGKNPFLGIAYLVVGSLCILMGFVMLVVYIRYQDQDDDDNDDE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacctggagcgcctcggcgcggggcgcgcagcagcccgacaacaccgccttcacgcag
cagcgcctccccgcctggcagccgctgctgtcggccggcatcacgctgccgctcttcttc
tgcgccggcctggcgttcatcggcctgggactgggcctcttctactcctccaacggcatc
caggagctggagtacgactacaccggcaaccccggcaccggcaactgctcggtgtgcgcc
gccaagggccaggaccgcgcgccgccgcccagctgccagtgctcctggagcttcacgctg
cccgagctcttcccgggccccgtgtacctctactacgagctgtccaacttttaccagaac
aaccggcgctacggcgtgtcccgcgacgacgctcagctcagcggcctggccagcgcgctg
cgccacccggccaacgagtgcgccccctaccagttcagctccgacggcctgcccatcgcg
ccgtgcggcgccattgccaacagcctcttcaacgattccttctcgctctggcaccagcgc
cagcccgcggaccctttcgtcgaggtgccgctcgaccgcaccgccatcgcctggtggact
gactaccacgtcaagttccgcaacccgccgctggtgaacggcagcctggcgctggccttc
aagggcacggcgccgccgcccaactggcaccggccggtttatgagctcagcccggatccc
aacaacaccggcttcatcaaccaggacttcgtggtgtggatgcgcaccgcagcgctgccc
acgttccgcaagctgtatgcgcgcatccgccagggcaactactcggccggtcttccccgg
ggcacttaccgggtcaacatcacctacaactaccccgtgcgcgccttcggcggccacaag
cttatcatccttagcaacatctcatggatgggtggcaagaacccttttctgggcatcgcc
tacctggtcgtcggctccctctgtatcctcatgggctttgtcatgctggtcgtctacatt
cgctaccaggaccaggatgacgacgacaatgacgatgagtga

DBGET integrated database retrieval system