KEGG   Rattus norvegicus (rat): 314264
Entry
314264            CDS       T01003                                 

Gene name
Rdh12
Definition
(RefSeq) retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    314264 (Rdh12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     314264 (Rdh12)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase AdoHcyase_NAD Pyr_redox_3 NAD_binding_10 GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 314264
NCBI-ProteinID: NP_001101507
RGD: 1310462
Ensembl: ENSRNOG00000056553
UniProt: D3ZEP9
Position
6q24
AA seq 316 aa
MLVILVLLTSFFSILYLATPSIRKFFAGGVCTTKVQIPGKVVVITGANTGIGKETARELA
RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRTFAEGFLAEEKKLH
ILINNAGVMMCPYSKTVDGFETHFGVNHLGHFLLTYLLLGRLKESAPARVINLSSVAHLG
GKIRFHDLQSKKRYCSGFAYSHSKLANVLFTRELAKRLQGTGVTAYVVHPGCVLSEITRH
SFLMCLLWRLFSPFFKSPWQGAQTSLHCALEEGLEPLSGKYFSDCKRTWVSPRARNKKTA
ERLWNVSCELLGIQWE
NT seq 951 nt   +upstreamnt  +downstreamnt
atgctggttatcttggtactgctcacgtccttcttctcgatcttgtacctggcgactcca
tccatcaggaagttctttgctggtggagtttgtacaacgaaggtgcagatcccagggaag
gtagtggtcatcacaggtgccaacacaggcattggcaaggagacagccagagagcttgct
cgaagaggagcacgagtatacattgcgtgtcgagatgtgctgaagggagagtctgctgcc
agtgaaatccgagcagacaccaagaactcccaggtgctagtgcggaaactggacctctct
gacaccaaatccatccgaacctttgctgagggcttcctagcagaggagaagaagcttcat
attttgatcaataatgcaggcgtgatgatgtgtccatattctaagacagtagatggcttt
gaaacccactttggagtcaaccacctgggccacttccttcttacatacctgcttttgggg
aggctgaaggagtctgctcccgcacgggtgataaacctatcctcggtggcccaccttggt
ggcaagatccgtttccatgacctccaaagcaagaagcgatactgcagtggtttcgcctat
agtcacagcaagctggccaacgtgcttttcacccgagagctggccaagcggctccaaggg
accggagtcacggcctatgtggttcacccaggttgcgtcctgtctgagatcaccaggcac
tccttcctgatgtgcctgttgtggcgcctcttctcgcccttcttcaagtccccttggcag
ggggctcagaccagcctgcactgcgccctggaggagggcctggagcccctgagcggaaag
tacttcagtgactgcaagaggacgtgggtatccccaagggcccggaacaagaaaacagct
gagcgcttgtggaatgtcagctgtgagcttctaggaatccagtgggaatag

DBGET integrated database retrieval system